BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F16 (893 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 27 1.0 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 9.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 9.5 AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 23 9.5 AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 23 9.5 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 26.6 bits (56), Expect = 1.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 390 IRCSGRLQWNYICLWSNKFWENTYHGRCHRR 482 I CS + WN + + ++ EN Y+ +C R Sbjct: 962 IMCSDEVTWNRVAEYVHEVMENQYNLQCSYR 992 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 9.5 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 166 ADREIAAEDSIRVVCRFRPLNDSEE 240 AD + A D+ VV FRP SEE Sbjct: 1303 ADGVLMARDAKTVVADFRPYRISEE 1327 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 9.5 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 166 ADREIAAEDSIRVVCRFRPLNDSEE 240 AD + A D+ VV FRP SEE Sbjct: 1304 ADGVLMARDAKTVVADFRPYRISEE 1328 >AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 566 Score = 23.4 bits (48), Expect = 9.5 Identities = 8/37 (21%), Positives = 22/37 (59%) Frame = -3 Query: 261 DKF*TSFFFRVIQWSKSAYHSDTVFSSNLAIGCHFFN 151 D F + ++ +++W+ +AY + + + + +G H F+ Sbjct: 110 DSFQGTIWYTLLRWNVTAYFLNLLPADAMTLGNHEFD 146 >AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleotidase protein. Length = 566 Score = 23.4 bits (48), Expect = 9.5 Identities = 8/37 (21%), Positives = 22/37 (59%) Frame = -3 Query: 261 DKF*TSFFFRVIQWSKSAYHSDTVFSSNLAIGCHFFN 151 D F + ++ +++W+ +AY + + + + +G H F+ Sbjct: 110 DSFQGTIWYTLLRWNVTAYFLNLLPADAMTLGNHEFD 146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,707 Number of Sequences: 2352 Number of extensions: 16084 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -