BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F15 (857 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 2.9 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 24 5.1 Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 9.0 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 2.9 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 Query: 480 SCRRGAGILFPTTACHGPHSLRGRDSWTPEGSH 382 SC R AG F T+ S R S + GSH Sbjct: 1330 SCERIAGETFECTSTSSKFSTSSRGSGSDSGSH 1362 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.2 bits (50), Expect = 5.1 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +1 Query: 481 LNIPRISFFYAETTSVP----ASIGFMGFTMSAKGGITLNYGRRSQTASTVFPL 630 + I R + +Y VP +S+ +GFT+ G L G + TVF L Sbjct: 225 IQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGLTILVSQTVFSL 278 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 Query: 411 RDSWTPEGSHHTQTT 367 ++ W PE +HH Q T Sbjct: 37 KEKWVPEITHHCQKT 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 900,500 Number of Sequences: 2352 Number of extensions: 20940 Number of successful extensions: 43 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -