BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F11 (841 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29190| Best HMM Match : No HMM Matches (HMM E-Value=.) 241 4e-64 SB_22642| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_912| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 31 1.5 SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041) 30 2.0 SB_38055| Best HMM Match : zf-CW (HMM E-Value=1.9) 30 2.7 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_53929| Best HMM Match : Amelogenin (HMM E-Value=3.6) 29 3.6 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 29 3.6 SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) 29 3.6 SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 4.7 SB_4395| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_51309| Best HMM Match : LicD (HMM E-Value=0.0069) 29 6.2 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) 29 6.2 SB_59186| Best HMM Match : rve (HMM E-Value=0.00029) 28 8.2 SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13) 28 8.2 SB_1237| Best HMM Match : rve (HMM E-Value=0.00029) 28 8.2 >SB_29190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 241 bits (591), Expect = 4e-64 Identities = 123/149 (82%), Positives = 134/149 (89%) Frame = +1 Query: 112 NNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII 291 + P Y FFGVMGA +A++FSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII Sbjct: 5 DQPSYVAFFGVMGATAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII 64 Query: 292 AIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQ 471 AIYGLVVAVLI ++ + +Y LYK F+ LGAGL+VG SGLAAGFAIGIVGDAGVRGTAQ Sbjct: 65 AIYGLVVAVLIGSSISK--DYTLYKSFLDLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQ 122 Query: 472 QPRLFVGMILILIFAEVLGLYGLIVAIYL 558 QPRLFVGMILILIFAEVLGLYGLIVA+ L Sbjct: 123 QPRLFVGMILILIFAEVLGLYGLIVALIL 151 >SB_22642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1574 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -1 Query: 595 REWCVF---RAFILCTGRWRR*VRKDPILQRK*E*ESFRRIT*AAEQYHARLHLP 440 R WCV+ R+ I CT RW R V P + + +S RR+ E + L+ P Sbjct: 931 RGWCVYHMGRSLIACTRRWMRKVACSPSKETRPHRQSSRRLASQQESQQSLLNAP 985 >SB_912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 31.5 bits (68), Expect = 0.88 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 382 GAGLAVGFSGLAAGFAIGIVG 444 GAG+ VGF LA G +G+VG Sbjct: 46 GAGMTVGFCNLACGICVGLVG 66 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 264 HSCRHGGYYCHLRSGRGCPDCWCPPGASQLPPLQRV 371 + CR+ G C + R P C CPPG QRV Sbjct: 2981 YKCRYQGEVC-VTDSRNVPRCVCPPGCPPAEVSQRV 3015 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 503 IRIIPTNNLGC*AVPRTPASPTMPMAKPAARPENPTAKPAP 381 ++I+P N + PR P + T P P P PT P P Sbjct: 205 VKILPGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVP 245 >SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 429 GETGSQTRESYSQTSTQVDEPFVKGVVGWLLEGTSNQDSHDQTV 298 G+ +T SYS S+QV +PF V +QD H+QT+ Sbjct: 713 GDVQKETTGSYSCNSSQVFDPFTLQCVNLPQPIKQHQDKHNQTL 756 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 429 GETGSQTRESYSQTSTQVDEPFVKGVVGWLLEGTSNQDSHDQTV 298 G+ +T SYS S+QV +PF V +QD H+QT+ Sbjct: 44 GDVQKETTGSYSCNSSQVFDPFTLQCVNLPQLIKQHQDKHNQTL 87 >SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041) Length = 1155 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 455 TPASPTMPMAKPAARPENPTAKPAPKWMNPL 363 TPA PT+PMA A + P+ PA PL Sbjct: 1095 TPALPTIPMAPSGAPAKTPSVAPAAPSPRPL 1125 >SB_38055| Best HMM Match : zf-CW (HMM E-Value=1.9) Length = 439 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -1 Query: 463 YHARLHLPRCLWRNRQPDQRILQPNQHPSG*TLCKGGSWLAPGGHQQSGQ--PRPDRRW 293 YHA+ + +C ++P +L Q S C PGGHQ Q R RW Sbjct: 264 YHAKNQVVKCYQPGKEPGGHLLPTYQAKSQAVKCYYIPGKEPGGHQAKNQAVTRQRTRW 322 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 448 HLPRCLWRNRQPDQRILQPNQHPSG*TLCKGGSWLAPG-GHQQSGQ 314 ++ +++ Q +Q +L NQ PS T+ GGS G GH GQ Sbjct: 2347 YVSHTVFKREQDEQLLLWLNQRPSDWTMTWGGSGTIYGWGHNHRGQ 2392 >SB_53929| Best HMM Match : Amelogenin (HMM E-Value=3.6) Length = 156 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 452 PASPTMPMAKPAARPENPTAKPAPK 378 PA+P P A PAA P PTA PA + Sbjct: 52 PAAPVTPTAAPAA-PVTPTAAPAAR 75 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 452 PASPTMPMAKPAARPENPTAKPA 384 PA+P P A PAAR PTA PA Sbjct: 62 PAAPVTPTAAPAAR-VTPTAAPA 83 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = -3 Query: 530 RPNTSAKIRIRIIPTNNLGC*AVPRTPASPTMPMAKPAARPENPTAKPAPKWMNPL 363 +P T+ K R PT +L + +PT AKP PT +P K PL Sbjct: 135 KPKTTVKRRPTERPTKSLLPEEEEKERQTPTPTKAKPTTIKRRPTERPTKKPTKPL 190 >SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 264 HSCRHGGYYCHLRSGRGCPDCW 329 +SC G YYC++ RG DCW Sbjct: 348 YSCNSGHYYCYV---RGSNDCW 366 >SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) Length = 404 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 452 PASPTMPMAKPAARPENPTAKPAPK 378 PA+P P A PAA P PTA PA + Sbjct: 209 PAAPVTPTAAPAA-PVTPTAAPAAR 232 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 452 PASPTMPMAKPAARPENPTAKPA 384 PA+P P A PAAR PTA PA Sbjct: 219 PAAPVTPTAAPAAR-VTPTAAPA 240 >SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 233 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -3 Query: 491 PTNNLGC*AVPRTPASP--TMPMAKPAARPENPTAKPAP 381 P+NN G A P TPA+P M +A P+ T P P Sbjct: 87 PSNNFGTPATPATPATPAHNMGVAGPSGMATPGTFIPPP 125 >SB_4395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 627 IMSIEARSTGDGSGVCSGRLFCVQVDGDDKSVKTQYFSENKNKN 496 + ++ +STGD S VC G +F D K + Q E K N Sbjct: 15 LSALNKKSTGDKSWVCFGNMFMKLPDSKTKDMIIQGLQEVKGFN 58 >SB_51309| Best HMM Match : LicD (HMM E-Value=0.0069) Length = 466 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +2 Query: 116 IQSTDPSLELWGRRLLSSSAPWELPMEL 199 I S D LELWG R LS+SA LP EL Sbjct: 355 ILSGDFYLELWGARELSNSALNFLPAEL 382 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 464 VPRTPAS-PTMPMAKPAARPENPTAKPAPKWMNP 366 +P TP P P P RP PT +P P P Sbjct: 1354 IPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 >SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) Length = 355 Score = 28.7 bits (61), Expect = 6.2 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = -3 Query: 488 TNNLGC*AVPRTPASPTMPMAKPA--ARPENPTAKPAPKWMNPL*RG*LAGSWRAPAIRT 315 +NN G A P TPA+ +P+A P+ A P T PAP + P A + ++ Sbjct: 220 SNNFGTPATPATPAN-GVPIAGPSGMATPGAFTPPPAPVFTPPPPYRTTAKPFPKMSLTP 278 Query: 314 ATTRP*MAIIPAMTTGMIDFMISS 243 +P + P +T ++ ++ S Sbjct: 279 TPKKPPVPKKPVLTPAQLEGLLKS 302 >SB_59186| Best HMM Match : rve (HMM E-Value=0.00029) Length = 346 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 455 TPASPTMPMAKPAARPENPTAKPAPKWMNPL 363 TPA PT+P A A + P+ PA PL Sbjct: 286 TPALPTIPQAPSGAPAKTPSVAPAAPSPRPL 316 >SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13) Length = 347 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 455 TPASPTMPMAKPAARPENPTAKPAPKWMNPL 363 TPA PT+P A A + P+ PA PL Sbjct: 290 TPALPTIPQAPSGAPAKTPSVAPAAPSPRPL 320 >SB_1237| Best HMM Match : rve (HMM E-Value=0.00029) Length = 1026 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 455 TPASPTMPMAKPAARPENPTAKPAPKWMNPL 363 TPA PT+P A A + P+ PA PL Sbjct: 966 TPALPTIPQAPSGAPAKTPSVAPAAPSPRPL 996 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,544,275 Number of Sequences: 59808 Number of extensions: 677647 Number of successful extensions: 2293 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2265 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -