BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F11 (841 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 28 0.41 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 27 0.54 Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 27 0.94 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 27 0.94 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 1.2 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 26 1.6 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 2.9 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 24 5.0 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 24 6.6 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 6.6 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 6.6 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 27.9 bits (59), Expect = 0.41 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 533 TDLSSPSTCTQNKRPEHTPLPSPV 604 +D+SSP T + P+ TP P+PV Sbjct: 168 SDMSSPGAPTGSSSPQITPRPTPV 191 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 27.5 bits (58), Expect = 0.54 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 718 VIYKSGRCSEPYARWTRYRRRPSLCASSDSDNEHRG 611 +I++SG SE + RW RR S +++ +EH G Sbjct: 306 MIHESGAWSEVHRRWFFLPRRCSRARYNETRDEHMG 341 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 26.6 bits (56), Expect = 0.94 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 286 IIAIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAG 453 ++A L VA+++ A+ NY G+ G G + FSG + G +I + D G Sbjct: 5 LVAFATLSVALVVVVAIPANFNYGGGGGYFINGTGQSFNFSGESNGTSIPGLPDFG 60 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 26.6 bits (56), Expect = 0.94 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 286 IIAIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAG 453 ++A L VA+++ A+ NY G+ G G + FSG + G +I + D G Sbjct: 5 LVAFATLSVALVVVVAIPANFNYGGGGGYFINGTGQSFNFSGESNGTSIPGLPDFG 60 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 26.2 bits (55), Expect = 1.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 264 HSCRHGGYYCHLRSGRGCPDCWCPP 338 + C++G Y ++ SG GC C C P Sbjct: 921 NECKNG--YWNIVSGNGCESCNCDP 943 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 25.8 bits (54), Expect = 1.6 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 112 FQPFCLLNVGVFTGPKNCDDYLHTL 38 F P+ +L +G+ G + +LHTL Sbjct: 750 FWPWSVLTIGILVGMEGLSAFLHTL 774 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 25.0 bits (52), Expect = 2.9 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -3 Query: 521 TSAKIRIRIIPTNNLGC*AVPRT--PASPTMPMAKPAARPENPTAKPAPK 378 TS R + P + L A PR P +KP A P+ +A PAP+ Sbjct: 68 TSVDCRTSLAPCSKLFA-AEPRVALPKLSATGASKPIAEPKAASATPAPE 116 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 24.2 bits (50), Expect = 5.0 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -2 Query: 327 SNQDSHDQTVDGNNTRHDDRNDRLHDQLRPHH 232 + ++S Q+ N+ ++ + H Q +PHH Sbjct: 325 NKKNSQRQSAQANSGSSNNSSSHSHSQAQPHH 356 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.8 bits (49), Expect = 6.6 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = -1 Query: 709 KSGRCSEPYARWTRYRRRPSLCASSDSDNEHRGSEHGRREWCVFRAFILCTGRW 548 K+G C + +YR SL A HR +E R +W R IL RW Sbjct: 203 KNGCCRKTCGTGWKYRSISSLHAPPSHPGAHRAAE-PRLDW---RIKILPLPRW 252 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 6.6 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -2 Query: 444 SHDAYGETG-SQTRESY-SQTSTQVDEPFVKGVVGWLLEGTSNQDSHD 307 S D GE+ S +R S +T++QVD KG L+GT+ HD Sbjct: 1654 SSDVEGESECSSSRSSIVEETASQVDMKGRKGTNSSPLDGTTTIIIHD 1701 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 6.6 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 449 ASPTMPMAKPAARPENPTAKPAP 381 A M + PAA PTA P P Sbjct: 67 AEAAMDLEPPAAAQPTPTASPVP 89 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 960,152 Number of Sequences: 2352 Number of extensions: 21630 Number of successful extensions: 91 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -