BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F08 (871 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 25 2.3 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 4.0 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 392 AHQNC*GGKEGACSVYSRETRPLY 463 AHQ+C G + +++S PLY Sbjct: 48 AHQSCAGAHQSPIAIHSHRAVPLY 71 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.6 bits (51), Expect = 4.0 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -3 Query: 656 FDFDFVRLVNVDLDFIRYFLFNGVRFRYVYWVFDVFLDGKGN 531 F+F++ + N + F F + YW D F GK N Sbjct: 1552 FNFEYKDVSNYAKNLTYQFFDYARYFTFPYWNEDYFFQGKHN 1593 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,562 Number of Sequences: 2352 Number of extensions: 10990 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93026475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -