BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F07 (834 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 3.9 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 22 6.9 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 6.9 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 548 ARRKIKCRGENSKREGSYPERHVESLAEAETW 453 A + ++ G+ SKR+G+Y R + E W Sbjct: 347 AGKHLRKVGDPSKRKGTYAFRTPDENGEGGAW 378 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/37 (21%), Positives = 17/37 (45%) Frame = +2 Query: 287 NQTQSASLSCLQGCHQQRESDPALWKRKHKAGRPKKQ 397 N + ++ L Q + DP+ W+++ K K+ Sbjct: 115 NNGTNKNMRRLSTTTQNKNDDPSYWEKRRKNNEAAKR 151 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 487 DMWNPSPKPKPGKP 446 ++ NPS KPGKP Sbjct: 680 NLQNPSTGSKPGKP 693 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,073 Number of Sequences: 336 Number of extensions: 4215 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22932949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -