BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F07 (834 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 137 1e-32 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 60 3e-09 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 50 2e-06 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 49 4e-06 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 49 4e-06 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 49 4e-06 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 47 2e-05 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 46 4e-05 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 46 5e-05 SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) 45 9e-05 SB_51713| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 43 4e-04 SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 42 5e-04 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 42 5e-04 SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 42 6e-04 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 41 0.001 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) 41 0.001 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 41 0.001 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 40 0.002 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 40 0.002 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 40 0.002 SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) 39 0.004 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 39 0.006 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 39 0.006 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 38 0.010 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 38 0.010 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 38 0.010 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 38 0.013 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 38 0.013 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 38 0.013 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 38 0.013 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 38 0.013 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 37 0.018 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 37 0.018 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 37 0.018 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 37 0.018 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 37 0.018 SB_27455| Best HMM Match : Extensin_2 (HMM E-Value=0.75) 37 0.018 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 37 0.018 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 37 0.018 SB_12329| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30) 37 0.023 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 36 0.041 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 36 0.041 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 36 0.041 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 36 0.041 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 36 0.041 SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_11979| Best HMM Match : zf-C3HC4 (HMM E-Value=0.061) 36 0.054 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 36 0.054 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 35 0.071 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.071 SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.071 SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 35 0.094 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 35 0.094 SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 35 0.094 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 35 0.094 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 34 0.12 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) 34 0.12 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_3322| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 33 0.29 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 33 0.29 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) 33 0.38 SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 33 0.38 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_11289| Best HMM Match : zf-TRAF (HMM E-Value=1.7e-08) 32 0.50 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.66 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 32 0.66 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_33822| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0022) 31 0.87 SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) 31 1.2 SB_31765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_7109| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0029) 31 1.2 SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 31 1.5 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 30 2.0 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_37872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_23642| Best HMM Match : Neuromodulin (HMM E-Value=4.7) 30 2.0 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 30 2.7 SB_35671| Best HMM Match : zf-C3HC4 (HMM E-Value=0.01) 30 2.7 SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) 30 2.7 SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) 29 3.5 SB_106| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_3579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_54202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_40458| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_34466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) 29 6.1 SB_31352| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_48235| Best HMM Match : zf-C3HC4 (HMM E-Value=0.12) 28 8.1 SB_12595| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_55125| Best HMM Match : zf-C2HC (HMM E-Value=1.5e-13) 28 8.1 SB_51720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_26397| Best HMM Match : zf-C3HC4 (HMM E-Value=0.78) 28 8.1 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 137 bits (331), Expect = 1e-32 Identities = 54/69 (78%), Positives = 64/69 (92%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLYGRGNT 374 ECNICLDTARDAV+SMCGHLFCWPCLH+WLETRP+R +CPVCKA IS+EKVIPL+GRG++ Sbjct: 62 ECNICLDTARDAVISMCGHLFCWPCLHRWLETRPNRSMCPVCKAGISKEKVIPLFGRGSS 121 Query: 375 KQEDPRNKV 401 +DPR+ V Sbjct: 122 SNQDPRHLV 130 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 59.7 bits (138), Expect = 3e-09 Identities = 25/62 (40%), Positives = 39/62 (62%) Frame = +3 Query: 174 KHDERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIP 353 K D+ +L CNIC+ +A+ ++CGH FC CL WL +RP Q CP C++ + +IP Sbjct: 11 KIDQNLL-CNICVGVLENAITTICGHSFCESCLETWL-SRPEVQSCPSCRSHVLSLDLIP 68 Query: 354 LY 359 ++ Sbjct: 69 VH 70 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/78 (26%), Positives = 40/78 (51%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLYGRGNT 374 EC ICLD D ++ C H+FC CL +E CP+C+A +++ +++ + Sbjct: 64 ECPICLDPLDDPSITRCAHVFCTGCLTDVIENEGLAPRCPMCRAPVNQNELVKVPEERLR 123 Query: 375 KQEDPRNKVPPRPAGQRT 428 ++E + AG+++ Sbjct: 124 EKETEKEGGKEETAGRKS 141 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 49.2 bits (112), Expect = 4e-06 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C IC + + + C H FC C+ +WL+ ++ CPVCKA+IS Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVCKASIS 205 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 49.2 bits (112), Expect = 4e-06 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C IC + + + C H FC C+ +WL+ ++ CPVCKA+IS Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVCKASIS 79 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 49.2 bits (112), Expect = 4e-06 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C IC + + + C H FC C+ +WL+ ++ CPVCKA+IS Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVCKASIS 205 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 49.2 bits (112), Expect = 4e-06 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C IC + + + C H FC C+ +WL+ ++ CPVCKA+IS Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVCKASIS 205 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/54 (31%), Positives = 33/54 (61%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPL 356 EC +C + V + CGH+FC CL++ L+ RP CP+C++++++ + + Sbjct: 378 ECTLCCRLFYNPVTTPCGHVFCRACLNRSLDHRPG---CPICRSSLTQNVTVAI 428 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISR 338 EC +C + + V S+CGH FC CL++ L+ R CP C+A +++ Sbjct: 329 ECKLCFNLLLEPVTSLCGHSFCRDCLYRSLDHRVE---CPCCRAPLTK 373 Score = 34.7 bits (76), Expect = 0.094 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 186 RMLECNICLDTARDAVVSMCGHLFCWPCL 272 R EC +C D D V +CGH +C C+ Sbjct: 18 RFFECGLCGDFYVDPVTILCGHTYCLACI 46 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = +3 Query: 174 KHDERMLECNICLDTARDAVVSMCGHLFCWPCLHQWL-----ETRPSRQVCPVCKAAISR 338 K D +L C IC + AV++ CGH FC CL W+ E CP C+A + + Sbjct: 11 KVDPNLL-CGICAEVLERAVLTPCGHSFCGVCLETWMNAKLEENEKCPASCPSCRADLYQ 69 Query: 339 EKVIPL 356 IP+ Sbjct: 70 GDTIPV 75 >SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) Length = 695 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAI 332 C IC + +D + CGHL C CL QW E CP C++ I Sbjct: 185 CKICAENNKDVRIEPCGHLMCHLCLEQWQE--KGGDGCPFCRSPI 227 >SB_51713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKA 326 C IC + +D + CGHL C CL QW E CP C++ Sbjct: 381 CKICAENNKDVRIEPCGHLMCHLCLEQWQE--KGGDGCPFCRS 421 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +3 Query: 198 CNICLDTARDAVVS---MCGHLFCWPCLHQWLETRPSRQVCPVCKAAISR 338 C ICL+ + +CGH +C PCL +WLE + CP+C+ SR Sbjct: 262 CPICLEEFTPETPTRLLVCGHKYCEPCLSRWLE---NNTTCPICRKPTSR 308 >SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 406 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = +3 Query: 177 HDERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPL 356 H R L C C +DA+++ C H+FC+ CL +TR ++ CP C A + Sbjct: 348 HQAR-LTCPCCNTRKKDAILTKCFHVFCYECLKTRYDTR--QRKCPKCNATFGSNDFHKM 404 Query: 357 Y 359 Y Sbjct: 405 Y 405 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKV 347 E C +C + A C H FC CL WL R CP+C+ A+ + V Sbjct: 366 EDEFSCIVCQELFIRATTLTCSHSFCEYCLQSWLR---KRNTCPICRCAVQSQPV 417 >SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 158 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLY 359 L C C +DA+++ C H+FC+ CL +TR ++ CP C A +Y Sbjct: 104 LTCPCCNTRKKDAILTKCFHVFCYECLKTRYDTR--QRKCPKCNATFGSNDFHKMY 157 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 192 LECNICLDTARDA-VVSMCGHLFCWPCLHQWLETRPSRQVCPVC--KAAISREKV 347 L C++C + D ++ C H FC CLH+ L R CP+C K A+ R V Sbjct: 66 LRCSVCYEVFSDPRTLTACLHSFCKECLHKMLSKRSKYIHCPLCRKKTAVPRRGV 120 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPV-C-KAAISREKVIP 353 +C IC D +V+ CGH+FC CL W+ CP+ C + AI K IP Sbjct: 56 KCGICFGVLEDPLVTTCGHVFCSQCLVHWI---AENGTCPLTCEQLAIDDLKKIP 107 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 180 DERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAI 332 D L C IC +T + V C H FC CL + + ++ VCP C+ ++ Sbjct: 11 DHYRLVCGICQETYNNPKVLPCLHSFCQNCLDKSIRSQERVLVCPTCQCSV 61 >SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) Length = 499 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = +3 Query: 174 KHDERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIP 353 +H +L C+IC+ VV+ C +FC C+ WL + C C++ + + P Sbjct: 324 EHLVSILVCSICMGVPSTPVVTQCDQIFCSGCITAWLR---NAGACSSCRSVLEVSDIDP 380 Query: 354 LYG 362 L G Sbjct: 381 LKG 383 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 192 LECNICLDTARDAVV-SMCGHLFCWPCLHQWLETRPSRQVCPVCKA 326 + C +CL+ + +V CGH C CL + P +CPVC++ Sbjct: 21 ISCPVCLEVFEEPLVLPSCGHSVCLQCLQNMTKRNPPSLLCPVCRS 66 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 195 ECNICLDTAR-DAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCK 323 EC ICL+T + CGH FC PC+ E S ++CP C+ Sbjct: 677 ECPICLETITYPETLQGCGHTFCRPCI---TEASKSSKLCPTCR 717 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 195 ECNICLDTAR-DAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCK 323 EC ICL+T + CGH FC PC+ E S ++CP C+ Sbjct: 752 ECPICLETITYPETLQGCGHTFCRPCI---TEASKSSKLCPTCR 792 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKA 326 C +C +T D V+ C H FC C+ + + R + VCP C+A Sbjct: 405 CGVCRETYTDPRVAPCLHSFCKECVTKLVTERQGKFVCPDCQA 447 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 L C++CL+ R+ + C H FC CL + ++ +CP C+ S Sbjct: 20 LTCSVCLEQFREPKMLPCFHTFCKECLEKTKQSFRGNLLCPTCRTKTS 67 >SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQ--VCPVCKAAISR 338 E +L C C + ++ ++ C H FC CL++ +RP + CP CK I + Sbjct: 11 EELLTCRQCSNVFKNPRITPCLHSFCAECLNEIARSRPYQAYIACPTCKYEIRK 64 >SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) Length = 671 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +3 Query: 210 LDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVI 350 L+ ++ VV H+FC PCL WL T + CP C+ I++++ + Sbjct: 107 LEKVKEPVVCPNQHVFCSPCLDLWLRT---NRYCPTCRTPINQDQPV 150 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQV-CPVC--KAAISREKV 347 C++CL+ +D V C H +C CL +E R V CP C K IS E+V Sbjct: 17 CSLCLEQYQDPRVLACLHTYCRHCLESLVEHSQERTVSCPQCREKIVISVEEV 69 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQV-CPVC--KAAISREKV 347 C++CL+ +D V C H +C CL +E R V CP C K IS E+V Sbjct: 17 CSLCLEQYQDPRVLACLHTYCRHCLESLVEHSQERTVSCPQCREKIVISVEEV 69 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 240 MCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVI 350 MCG +FC C + W+ T SR++ VC+ + +K I Sbjct: 965 MCGRIFCHSCSNNWVRTPHSRKMKRVCQCCLENDKQI 1001 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSICIEHFNDPRVLPCFHSFCLHCLEELAVHSEGRGKLVCPLCKA 59 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVRCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKAAISR 338 E + C+IC++ D V C H FC CL + R VCP+CKA + Sbjct: 10 EDEVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQK 63 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 9 EDEVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKA 58 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKAAISR 338 E + C+IC++ D V C H FC CL + R VCP+CKA + Sbjct: 9 EDEVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQK 62 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSICIEHLNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/56 (25%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 195 ECNICLDTARD-AVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLY 359 +C +C + +S CG++FC+PC++++L CPV ++++++ +Y Sbjct: 1200 QCPLCAKVRTNPTALSTCGYVFCYPCIYRYL---GQHGCCPVTHLPSTQQQLVRIY 1252 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETR---PSRQVCPVCKAAI 332 ++ +EC ICL+ +D V C H FC+ CL L +R + CP CK + Sbjct: 11 QKEVECPICLERFKDPRVLPCLHTFCYECL-VGLASRYKTEGKWPCPQCKMVV 62 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 15 CSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/62 (29%), Positives = 32/62 (51%) Frame = +3 Query: 189 MLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLYGRG 368 M C + L A+ ++ C H+FC C+ W + Q CP+C+A ++ + P++ G Sbjct: 483 MPTCQVKL--AKQIMLRTCKHIFCEDCISLWFD---REQTCPMCRARVAGD---PMWRDG 534 Query: 369 NT 374 T Sbjct: 535 TT 536 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EGEVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_27455| Best HMM Match : Extensin_2 (HMM E-Value=0.75) Length = 159 Score = 37.1 bits (82), Expect = 0.018 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +2 Query: 305 SLSCLQGCHQ-QRESDPALWKRKHKAGRPKKQGAPPAGRTAHGAGEYER---LPRFRLRR 472 S CL+ Q +R+S P WKR+ + K+ +PP + +++R P+++L Sbjct: 17 SADCLENLLQIKRDSSPPQWKRESTPPQWKRDSSPPQWKRDSSPPQWKRDSSPPQWKLDS 76 Query: 473 GIPHVVRDRSLPVW 514 P RD S P W Sbjct: 77 SPPQWKRDSSPPQW 90 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +2 Query: 335 QRESDPALWKRKHKAGRPKKQGAPPAGRTAHGAGEYER---LPRFRLRRGIPHVVRDRSL 505 +R+S P WKR + K +PP + +++R P+++ P RD S Sbjct: 55 KRDSSPPQWKRDSSPPQWKLDSSPPQWKRDSSPPQWKRDSSPPQWKRDSSPPQWKRDSSP 114 Query: 506 PVW 514 P W Sbjct: 115 PQW 117 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETR---PSRQVCPVCKAAI 332 ++ +EC ICL+ +D V C H FC+ CL L +R + CP CK + Sbjct: 11 QKEVECPICLERFKDPRVLPCLHTFCYECL-VGLASRYKTEGKWPCPQCKMVV 62 >SB_12329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAI 332 L C +C+D +AV+ CGH+ C C + + + CPVC+ AI Sbjct: 144 LRCKVCMDEQINAVLIPCGHMVC--C----EQCAMNLEACPVCRGAI 184 >SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30) Length = 514 Score = 36.7 bits (81), Expect = 0.023 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +3 Query: 183 ERMLE---CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAI 332 ERM E C IC+D V CGHL C P + +E +CP+C+A I Sbjct: 465 ERMQEERLCKICMDAEVGIVFLPCGHLSCCPGCAEGME------LCPMCRAPI 511 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C++C++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 E + C++C++ D V C H FC CL + R VCP+CKA Sbjct: 10 EDEVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKA 59 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQV-CPVCKAAI 332 L C ICLD ++ C H C CL SR + CP+C++ I Sbjct: 19 LLCPICLDEFKEPKTLSCMHDLCRKCLEDMAARESSRVIRCPLCRSEI 66 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWL--ETRPSRQVCPVCKA 326 E + C++C++ D V C H FC CL + + VCP+CKA Sbjct: 10 EDEVTCSLCIEHFNDPRVLPCFHSFCRHCLEELAVHSEGKGKLVCPLCKA 59 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E CP+C+ ++ Sbjct: 168 CAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLA 213 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR--QVCPVCKA 326 C+IC++ D V C H FC CL + R VCP+CKA Sbjct: 20 CSICIEHFDDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKA 64 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E CP+C+ ++ Sbjct: 76 CAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLA 121 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E CP+C+ ++ Sbjct: 316 CAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLA 361 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E CP+C+ ++ Sbjct: 642 CAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLA 687 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 35.9 bits (79), Expect = 0.041 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 174 KHDERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLE-TRPSRQVCPVCK 323 K E + C IC++ D + C H FC CL E + + VCP+CK Sbjct: 7 KQLEDEVTCAICIEHFTDPRLLPCLHTFCRHCLEDLAEHSGKGKLVCPLCK 57 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +3 Query: 174 KHDERMLE---CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 + DE+ +E C ICL + VV C H FC C Q + + CP+C+ IS Sbjct: 26 QQDEKDIEDFTCPICLQLLVEPVVLPCEHEFCKMCFTQ--NVQEANLQCPMCRIRIS 80 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E CP+C+ ++ Sbjct: 174 CAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLA 219 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E CP+C+ ++ Sbjct: 319 CAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLA 364 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 35.9 bits (79), Expect = 0.041 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKV-IPLYGRGN 371 +C +CL A V CGH+FC+ C+ + + R SR+ C +C+ IS + + P + Sbjct: 70 DCPVCLQQASYPVRLPCGHMFCFLCI-KGVALR-SRK-CAICRQPISPDYLDKPTLVKVV 126 Query: 372 TKQEDPRNKVPPRP 413 + Q +K P P Sbjct: 127 SGQSSSSDKAPSDP 140 >SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E CP+C+ ++ Sbjct: 172 CAICLDVLEKPLSSKCQHSCCSDCWKSAFELGGKHPACPICQETLA 217 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 35.5 bits (78), Expect = 0.054 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHL-FCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLY 359 +C ICL+ R+ V+ CGH+ C C Q + CPVC+ I R ++P+Y Sbjct: 537 QCVICLENQRNVVLLNCGHVCSCRTCAQQIHQ-------CPVCRGDIVR--MVPIY 583 >SB_11979| Best HMM Match : zf-C3HC4 (HMM E-Value=0.061) Length = 63 Score = 35.5 bits (78), Expect = 0.054 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 192 LECNICLDTARDAVVSM-CGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLY 359 ++C IC++ +VS+ C H+ C C WL T ++++CP C S + +Y Sbjct: 9 VKCLICMEPYTVPLVSISCWHVHCEEC---WLRTLGAKKLCPQCNMITSPNDLRKIY 62 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +3 Query: 186 RMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPS-RQVCPVCKAAI 332 + L C IC RDA V C H +C C+ + R S R CP C I Sbjct: 141 QQLACGICHALLRDARVLPCLHTYCRRCIEDIILHRQSVRAHCPSCNREI 190 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 35.1 bits (77), Expect = 0.071 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLE-TRPSRQVCPVC--KAAISREKV 347 C++CL+ +D V C H +C CL +E ++ CP C K IS E+V Sbjct: 26 CSLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIEISVEEV 78 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 35.1 bits (77), Expect = 0.071 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = +3 Query: 180 DERMLECNICLDTARDAV---VSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAI--SREK 344 DE C ICLD ++ + C H + C+ WL ++ CPVCK + S++K Sbjct: 295 DEYYDVCAICLDEYKEGDKLRILPCDHAYHCKCVDPWLTE--GKRTCPVCKRPVETSKKK 352 Query: 345 VIPLYGRGNTKQ 380 + G + +Q Sbjct: 353 KQGIQGSADAEQ 364 >SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 35.1 bits (77), Expect = 0.071 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C + CP+C+ ++ Sbjct: 25 CAICLDVLEKPLSSKCQHSCCSDCWESAFDLGEKHPACPICQETLA 70 >SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E + CP+C ++ Sbjct: 118 CAICLDVLGKPLSSKCQHSCCSDCWKSAFELGETHPACPICHETLA 163 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 34.7 bits (76), Expect = 0.094 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = +3 Query: 180 DERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQV-CPVC--KAAISREKV 347 D + + C +CL+ +D V C H +C CL E + CP C K IS +KV Sbjct: 10 DVKDVTCCLCLEQYQDPRVLACLHTYCRHCLESLAEHSQGDSISCPQCREKIQISVDKV 68 >SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C ICLD + S C H C C E + CP+C ++ Sbjct: 118 CAICLDVLGKPLSSKCQHSCCSDCWKSAFELGETHPACPICHETLA 163 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 34.7 bits (76), Expect = 0.094 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 183 ERMLECNICLDTARDAVVSMCGHLFCWPCLHQWL--ETRPSRQVCPVCKA 326 E + C++C++ D V C H FC CL + + VCP+CK+ Sbjct: 130 EDEVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGKGKLVCPLCKS 179 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +3 Query: 180 DERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLE-TRPSRQVCPVCKAAI 332 D + + C +CL+ +D V C H +C CL +E ++ CP C+ I Sbjct: 10 DVKDVTCCLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKI 61 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 34.3 bits (75), Expect = 0.12 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQW 281 C IC +D +++ CGH +C C+ +W Sbjct: 30 CAICHIVVKDPILTSCGHSYCKCCIQKW 57 >SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) Length = 259 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = +3 Query: 174 KHDERMLECNICL---DTARDAVVSMCGHLFCWPCLHQWL 284 +H + L C ICL T + A++ CG FC CL Q++ Sbjct: 16 RHRPKTLYCKICLADCPTKKGAILKSCGCFFCKECLKQYV 55 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLE-TRPSRQVCPVC--KAAISREKV 347 C++CL +D V C H +C CL +E ++ CP C K IS E+V Sbjct: 17 CSLCLGQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIEISVEEV 69 >SB_3322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 777 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +3 Query: 180 DERMLECNICLDTARDAVVSMCGHL-FCWPC-LHQWLETR 293 D+ +LEC IC+ RD ++ C HL C C H L+ R Sbjct: 243 DDNVLECVICMSDFRDTLILPCRHLCLCKACAFHALLQIR 282 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +3 Query: 180 DERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLE--TRPSRQVCPVCK 323 DE+ + C +CLD D + C H +C CL + + CP C+ Sbjct: 10 DEKDVTCLLCLDIFTDPRLLPCLHTYCKKCLEDLVSQCQKKGEIYCPQCR 59 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +3 Query: 198 CNICLDTARDAVVSM-CGHLFCWPCLHQWLETRPSRQVCPVCKAAISREK-VIPLYGRGN 371 C +C DA + C H FC C+ ++LET CPVC A I + + ++ + R N Sbjct: 48 CVLCGGYLVDATTIIECLHSFCRCCIVRYLET---SYRCPVCDAEIHKTRPLLNIRRRKN 104 Query: 372 TKQE 383 T ++ Sbjct: 105 TSEQ 108 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 7/54 (12%) Frame = -3 Query: 535 LNVEVKIPNGKA--PIPND-MWN-PSPKPKPGKP---LVLSGSVRCPAGRGGTL 395 +NV+VK+P+GK PIP +W P PK KP P +++ + + A G TL Sbjct: 181 VNVKVKMPDGKEYDPIPKQFLWTLPPPKKKPPAPDPLMLVKVAAKAGAHAGATL 234 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 33.1 bits (72), Expect = 0.29 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCL 272 L C +C +D V++ CGH FC C+ Sbjct: 192 LFCPLCRRVFKDPVITSCGHTFCQACI 218 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQV--CPVCK 323 L C +CL ++ ++ C H FC C+ + L + V CP C+ Sbjct: 18 LMCPVCLGEYKNPMLLRCYHSFCLRCVQELLHQSGEKGVVKCPQCR 63 >SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) Length = 1712 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +3 Query: 198 CNICLDTARDAVVSM---CGHLFCWPCLHQWLETRPSRQVCPVC 320 C++CL+ +A++ CG +FC CL L+ CP+C Sbjct: 782 CSLCLEDRTNAMLLTHDGCGRMFCRQCLGVMLKDADRTIDCPIC 825 >SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 617 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +3 Query: 195 ECNICLDTARDAVVSM---CGHLFCWPCLHQWL--ETRPSRQVCPVCKAAISREK 344 EC ICLD + + CGH F C+ WL + CP C+ R K Sbjct: 559 ECVICLDEFKPGCTLLGLPCGHSFHQHCIEVWLAGDNTAPHHCCPNCRWPAYRAK 613 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 192 LECNICLDTARDA-VVSMCGHLFCWPCLHQWLETRPSRQVCPVCK 323 L C +CL+ ++ ++ C H C PCL + CP C+ Sbjct: 15 LTCPVCLEELKEPKCLTSCAHNVCKPCLDRMTFNGEKEIRCPTCR 59 >SB_11289| Best HMM Match : zf-TRAF (HMM E-Value=1.7e-08) Length = 230 Score = 32.3 bits (70), Expect = 0.50 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPL 356 C IC DAV GH+FC C+ L+ + CP+ ++ +S E + P+ Sbjct: 19 CPICQFIIEDAVCCPQGHIFCRSCVVVHLQQFGNGN-CPLDRSELSLEDIRPV 70 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +3 Query: 177 HDERMLECNICLDTARDAVVSMCGHLFCWPCL--HQWLETRPSRQVCPVCK 323 + + L C C + + C H FC CL H L + VCP+C+ Sbjct: 9 YSPQSLNCRACHKVFTEPKILDCLHTFCQKCLGTHDILGAGTNSIVCPLCR 59 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 31.9 bits (69), Expect = 0.66 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = +3 Query: 198 CNICLDTARDAVVSM-CGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLYGRGNT 374 C +C DA + C H FC C+ ++LET CPVC A I + + + L R + Sbjct: 16 CVLCGGYLVDATTIIECLHSFCRCCIVRYLET---SYRCPVCDAEIHKTRPL-LNIRADN 71 Query: 375 KQEDPRNKVPP 407 +D KV P Sbjct: 72 VLQDIVYKVVP 82 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 195 ECNICLDTARDAV-VSMCGHLFCWPCLHQ 278 EC IC RD + + CGH FC CL + Sbjct: 25 ECPICQLAFRDPIQIEECGHRFCQSCLQE 53 >SB_33822| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0022) Length = 229 Score = 31.5 bits (68), Expect = 0.87 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLYGR 365 C IC + V ++ H C CL Q L S CPVCK +S I + R Sbjct: 133 CPICSELLDKPVETIFTHNACGACLTQALAVNSS---CPVCKTILSSGDDIKKFNR 185 >SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) Length = 474 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSR-QVCPVCKAAIS 335 L C IC+D + CGH++C C +T S CP+CK I+ Sbjct: 404 LTCQICMDAEVNTAFCPCGHVYC--C-----QTCASNLYYCPLCKTFIT 445 >SB_31765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLYGRGNTK 377 C IC + V ++ H C CL Q L S CPVCK +S I + + + K Sbjct: 112 CPICSELLDKPVETIFTHNACGACLTQALAVNSS---CPVCKTILSSGDDIKKFNQQDIK 168 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFCWPCL-HQWLETRPSRQV--CPVCKAAI 332 EC++C T + + C H FC CL + E + + CP CK I Sbjct: 97 ECSLCHKTPSEPKILKCFHTFCNECLTEKSAEFKGDGETFSCPSCKTRI 145 >SB_7109| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0029) Length = 232 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C IC + V ++ H C CL Q L S CPVCK +S Sbjct: 86 CPICCELLDKPVETIFTHNACGACLTQALAVNSS---CPVCKTILS 128 >SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +3 Query: 195 ECNICLDTARDAVVSM-CGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIP 353 +C IC RD V + CGH FC CL P+ + ISR+KV P Sbjct: 41 QCPICQLPFRDPVQTRDCGHRFCESCLE------------PILRRCISRDKVYP 82 >SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 690 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = +3 Query: 195 ECNICLDTARD---AVVSMCGHLFCWPCLHQWLETRPSR 302 EC IC R+ + CGH FC C +L+++ SR Sbjct: 311 ECGICFGDFRENKMTALMSCGHSFCTECWEFYLKSQISR 349 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWL 284 L C IC D + +++ C H +C C+ WL Sbjct: 16 LLCCICRDVLEEPLMAPCEHSYCSACVLGWL 46 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/78 (19%), Positives = 35/78 (44%) Frame = +1 Query: 103 KWRRLVKRERAPRRLGATLVAKKTNMTKEC*NATSVWTQPVMQSSVCAATSSAGHVYING 282 +WR +K +P G+ V ++++ + N+T W +Q ++++ Sbjct: 162 QWRWNLKNFTSPTSTGSNGVMFRSSVNETLRNSTLQWRNVSLQCEWNLKNLYLANIHLLQ 221 Query: 283 WKPDPVGKSVLFARLPSA 336 W P+ + FA +P++ Sbjct: 222 WPSSPMNTTYAFASVPAS 239 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +3 Query: 180 DERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPV 317 D C +C T ++ VV+ C H FC C Q + VC V Sbjct: 239 DNLPFACIMCRKTFKNPVVTKCLHYFCEACALQHYKKNSKCFVCGV 284 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/59 (23%), Positives = 25/59 (42%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLYGRGN 371 +C++C + + + C H++C CL ET + + + K EK G N Sbjct: 13 KCSLCSEVLTEPKILRCFHVYCQKCLQ--AETNEAGEKSKILKCPCCLEKTETANGEAN 69 >SB_37872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 7/63 (11%) Frame = +3 Query: 174 KHDERMLECNIC---LDTARDAV-VSMCGHLFCWPCLHQWL---ETRPSRQVCPVCKAAI 332 +H + EC C L+T +D CG +FC C + TR QVC C A + Sbjct: 279 EHKDDARECRNCQKPLNTNKDKYHCHHCGKIFCEGCRSKTFSNSSTRRPHQVCDACYATL 338 Query: 333 SRE 341 + + Sbjct: 339 TND 341 >SB_23642| Best HMM Match : Neuromodulin (HMM E-Value=4.7) Length = 286 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +2 Query: 311 SCLQGCHQQRESDPALWKRKHKAGRPKKQGAPPAGRTAHGAGEYERLPRFRLRRGIPHVV 490 SCL Q+R S +L ++K +G P G P +A G+G+ + + + P VV Sbjct: 45 SCLPS--QERVSSRSLQEKKVTSGTPATSGVKPG--SARGSGKSRSANKQKTK---PQVV 97 Query: 491 RDRSLP 508 D+ LP Sbjct: 98 NDKPLP 103 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +3 Query: 198 CNICLDTARDAVVSM-CGHLFCWPCLHQWLETRPSRQVCPVCKAAISREK 344 C +C DA + C H FC C+ WL+ + CPVC + + + Sbjct: 1366 CVLCGGYLVDATTIVECLHSFCRSCIVSWLQ---ASYHCPVCDTEVHKTR 1412 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 L C +C + + + C H FC CL + R CP C+ ++ Sbjct: 143 LFCPLCHEMFANPRLLPCLHTFCKRCLENLVPPRSHTLSCPSCRLDVA 190 >SB_35671| Best HMM Match : zf-C3HC4 (HMM E-Value=0.01) Length = 527 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAISREKVIPLYGR 365 C IC + V ++ H C CL Q L +CPVCK +S I + R Sbjct: 252 CPICSELLDKPVETIFTHNACDACLTQALAV---NSLCPVCKTILSSGDDIKKFNR 304 >SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) Length = 1207 Score = 29.9 bits (64), Expect = 2.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 237 SMCGHLFCWPCLHQW 281 +MCG FCW CL W Sbjct: 846 TMCGGHFCWECLKDW 860 >SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 198 CNICL---DTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCK 323 C ICL + C HLF C+ WLE S CPVC+ Sbjct: 62 CPICLGDYEKGESTKQMPCDHLFHPGCILPWLEKTNS---CPVCR 103 >SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) Length = 549 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 3/68 (4%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS--REKVIP-LYGRG 368 C C D + C H C CL + + CPVC + E+++P + R Sbjct: 21 CRYCNGIFEDPRLLPCLHSLCKKCLKDIEQAQEGAIACPVCLTDVECHLEELLPNVLARS 80 Query: 369 NTKQEDPR 392 K+ + R Sbjct: 81 KLKERENR 88 >SB_106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 13/55 (23%) Frame = +3 Query: 198 CNICLDTA---------RDAVVSMCGHLFCWPCLHQWLETRPSR----QVCPVCK 323 C +CLD R ++ C H FC C+ +W + + + CP+C+ Sbjct: 174 CAVCLDVVMSKPKQSERRFGILPNCIHAFCLECIRKWRKASHAEKKVVRACPICR 228 >SB_3579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Frame = +3 Query: 180 DERMLECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQ-VCPVCKAAISREKVIPL 356 D+ C+ C + + C ++ CL L T P+ +CP CK S+ +P Sbjct: 181 DDHEDACSECKASGELLMCDTCTLVYHLSCLDPPLTTIPTGMWICPKCKETASKSDTVPW 240 Query: 357 YG 362 G Sbjct: 241 PG 242 >SB_54202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 28.7 bits (61), Expect = 6.1 Identities = 24/66 (36%), Positives = 28/66 (42%), Gaps = 16/66 (24%) Frame = +3 Query: 192 LECNICL-----DTARDAVVS--MCGHLFCWPCLHQWLETRP-SRQ-------VCPVC-K 323 +EC IC DT D CG F CL++WL + P SRQ CP C K Sbjct: 51 MECGICYAYRLNDTIPDKACDDPRCGQPFHRDCLYEWLRSLPSSRQSFNMVFGECPYCSK 110 Query: 324 AAISRE 341 I E Sbjct: 111 VGIDEE 116 >SB_40458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +3 Query: 273 HQWLETRPSRQVCPVCKAAISREKVIPLYGRGNTKQEDPRNKVPPRPAGQRTEPESTS 446 HQ + + S CP CK S E R ++E+P + V R +RT+ E++S Sbjct: 371 HQKQKEQGSTPECPKCKGVHSLETCEE--NRNGEERENPESSVINRIVTKRTQNEASS 426 >SB_34466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 6.1 Identities = 8/33 (24%), Positives = 17/33 (51%) Frame = +3 Query: 267 CLHQWLETRPSRQVCPVCKAAISREKVIPLYGR 365 C+ +WL+ + CP C A ++ + +Y + Sbjct: 155 CIERWLKAKGGSDKCPQCNAPAKKKDIRNIYAK 187 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVC 320 L C++C R + C H FC CL + CP C Sbjct: 18 LNCSLCHRLIRGPKLLPCLHSFCLACLEDLVTENDVGFNCPQC 60 >SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.7 bits (61), Expect = 6.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 195 ECNICLDTARDAVVSMCGHLFC 260 +C +C+ AR ++ CGH FC Sbjct: 99 QCPVCITDARFLTMTNCGHEFC 120 >SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) Length = 942 Score = 28.7 bits (61), Expect = 6.1 Identities = 21/69 (30%), Positives = 29/69 (42%) Frame = +2 Query: 221 P*CSRQYVRPPLLLAMFTSMVGNQTQSASLSCLQGCHQQRESDPALWKRKHKAGRPKKQG 400 P Q + PP A S+ G QT + LQ Q+ P H +G+PK+ G Sbjct: 249 PNAQAQQMTPPSSAAPPQSLPGLQTSPS----LQPPSQRSTPSPQSMSALH-SGKPKRPG 303 Query: 401 APPAGRTAH 427 PP+ H Sbjct: 304 MPPSPSVPH 312 >SB_31352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVCKAAIS 335 C IC+D CGH+ C C +E + CP+C++ I+ Sbjct: 352 CQICMDVEVATAFCPCGHVVC--C----VECSALCKECPLCRSQIT 391 >SB_48235| Best HMM Match : zf-C3HC4 (HMM E-Value=0.12) Length = 109 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 192 LECNICLDTARDAV--VSMCGHLFCWPCLHQWLETRPSRQVCPVC 320 +EC IC + D + ++ C CL+ W + + R + P C Sbjct: 1 MECLICKEEEEDVMETINCCKQPMHHRCLNDWYKVQEYRGLLPTC 45 >SB_12595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 198 CNICLDTARDAVVSMCGHLFCWPCL 272 C+ C +DAV + CGH +C C+ Sbjct: 61 CSKCGFILKDAVQTDCGHRYCLSCI 85 >SB_55125| Best HMM Match : zf-C2HC (HMM E-Value=1.5e-13) Length = 405 Score = 28.3 bits (60), Expect = 8.1 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Frame = -3 Query: 640 GQANTSHSTNRIATHRNI-FDRNCSSSNWAVPRGAKLNVEVKIPNGKA---PIPNDMWNP 473 G +T H T R +THR+I + S A K + + P A P + +P Sbjct: 299 GCDSTGHVTGRFSTHRSIGACPIAAESRKAEKLQEKADSIISTPKTSAVPSPATPNPDDP 358 Query: 472 SPKPKPGKP 446 PK +PG+P Sbjct: 359 PPKKRPGRP 367 >SB_51720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 192 LECNICLDTARDAV--VSMCGHLFCWPCLHQWLETRPSRQVCPVC 320 +EC IC + D + ++ C CL+ W + + R + P C Sbjct: 1 MECLICKEEEEDVMETINCCKQPMHHRCLNDWYKVQEYRGLLPTC 45 >SB_26397| Best HMM Match : zf-C3HC4 (HMM E-Value=0.78) Length = 110 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +3 Query: 192 LECNICLDTARDAVVSMCGHLFCWPCLHQWLETRPSRQVCPVC 320 +EC IC + V+ C CL+ W + + R + P C Sbjct: 1 MECIICKEEEIMDVIQCCKQTMQNRCLNDWYKVQEYRGIEPTC 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,133,780 Number of Sequences: 59808 Number of extensions: 583012 Number of successful extensions: 1858 Number of sequences better than 10.0: 125 Number of HSP's better than 10.0 without gapping: 1581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1842 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -