BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F06 (859 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U46675-2|AAB52644.1| 125|Caenorhabditis elegans Hypothetical pr... 31 1.4 U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical pr... 30 1.8 AF016448-12|AAB65959.1| 316|Caenorhabditis elegans Hypothetical... 29 4.2 U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (gr... 29 5.6 U80437-4|AAK68244.1| 90|Caenorhabditis elegans Neurabin protei... 28 7.4 AF067609-11|AAC17532.2| 252|Caenorhabditis elegans Hypothetical... 28 7.4 Z81086-6|CAB03116.1| 610|Caenorhabditis elegans Hypothetical pr... 28 9.8 Z75531-12|CAA99806.4| 348|Caenorhabditis elegans Hypothetical p... 28 9.8 AC024877-2|AAF60905.2| 608|Caenorhabditis elegans Hypothetical ... 28 9.8 >U46675-2|AAB52644.1| 125|Caenorhabditis elegans Hypothetical protein F35A5.5 protein. Length = 125 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +3 Query: 600 VPYEVKVHVDKPYEVKVKVPTPYTVEKKIPYEVKVPVPXPLHC 728 +P V V P V VP P + +P V VPVP +C Sbjct: 7 IPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVPVQSNC 49 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 600 VPYEVKVHVDKPYEVKVKVPTPYTVEKKIPYEVKVPVPXPL 722 +P + V P V VP P + +P + VPVP P+ Sbjct: 5 IPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVPV 45 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 633 PYEVKVKVPTPYTVEKKIPYEVKVPVPXPL 722 P + + +P P V +P V VP+P P+ Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPM 31 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +3 Query: 600 VPYEVKVHVDKPYEVKVKVPTPYTVEKKIPYEVKVPVPXPL 722 +P + + + P V VP P V +P + +P+P P+ Sbjct: 1 MPPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPV 41 >U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical protein T26C11.2 protein. Length = 343 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 Query: 603 PYEVKVHVDKPYEVKVKVPTPYTVEKKIPYEVKVPVPXPLH 725 P + H KP+ + P P + K +P+ +P P P H Sbjct: 184 PKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPMPKH 224 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 600 VPYEVKVHVDKPYEVKVKVPTPYTVEKKIPYEVKVPVPXP 719 +P + H KP+ + P P + K +P+ +P P P Sbjct: 217 MPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPKP 256 >AF016448-12|AAB65959.1| 316|Caenorhabditis elegans Hypothetical protein F41E6.11 protein. Length = 316 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 633 PYEVKVKVPTPYTVEKKIPYEVKVPVPXP 719 P V VP P V+ +P V VPVP P Sbjct: 149 PQPVIQHVPVPVPVQVPVPIRVPVPVPVP 177 >U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (grd related) protein 6 protein. Length = 240 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/66 (28%), Positives = 26/66 (39%) Frame = -2 Query: 201 SLHRYLRNYVLHKILCHRCPFCLVSSLRLPSVCLSPPWQRQPRPTMPPK*PCTSLWSPND 22 S H Y + C CP + R+P C +P P P PP PC + + P Sbjct: 12 SFHFAFAQYPFGRGGCGGCPTPMCQP-RMP--CAAPMPMPMPMPVCPPPPPCPAQFCP-- 66 Query: 21 AEDLCP 4 +CP Sbjct: 67 PPPICP 72 >U80437-4|AAK68244.1| 90|Caenorhabditis elegans Neurabin protein 1, isoform c protein. Length = 90 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 99 SPPWQRQPRPTMPPK*PCTSLWSPNDAEDLCPV 1 SP QRQP P +PPK P S P+ +C + Sbjct: 37 SPRLQRQPPPPLPPKPP--SQCPPSPMSQVCVI 67 >AF067609-11|AAC17532.2| 252|Caenorhabditis elegans Hypothetical protein C23H5.1 protein. Length = 252 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 707 GHFHFVRDFLLNGVGSGHFDFDFVR 633 GH ++ L G G+GH+ FDF+R Sbjct: 32 GHILVGKEVLDVGCGNGHYSFDFLR 56 >Z81086-6|CAB03116.1| 610|Caenorhabditis elegans Hypothetical protein F53B6.6 protein. Length = 610 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = -3 Query: 206 AVAFIATSEIMSSIRSYVIDAPFVLFLLFDCLRCAFLLLGKGNHGQRCHQNNR 48 +++F ++SE+ S S VI + +L LF C+ FL+ + N H + R Sbjct: 553 SLSFQSSSEVCLSKTSTVIFSTAILLALFCCVTVKFLVTRQRNRQLLHHASKR 605 >Z75531-12|CAA99806.4| 348|Caenorhabditis elegans Hypothetical protein C54D10.6 protein. Length = 348 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -3 Query: 203 VAFIATSEIMSSIRSYVIDAPFVLFLLFDCLRCAFLLLG 87 + IAT ++S+I + ++ P+ +F C RC + G Sbjct: 283 LCLIATHGLLSTITTIMVHKPYRVFFFILCRRCLLMPAG 321 >AC024877-2|AAF60905.2| 608|Caenorhabditis elegans Hypothetical protein Y95B8A.7 protein. Length = 608 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 430 RIQSRNTSPIPSRRKYPMR*KCPYLSP-TPSKRKFPLPSRNTSNTQYTYLN 579 R Q + + +P+ + P K P+ +P P R+F + T N +Y LN Sbjct: 221 RSQEKRKNQLPAVHEPPSFMKTPWFAPPAPEGREFNIVDDRTINEKYAGLN 271 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,694,341 Number of Sequences: 27780 Number of extensions: 299188 Number of successful extensions: 1071 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1056 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2139963672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -