BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F05 (867 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 32 0.005 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 7.2 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 22 7.2 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 22 7.2 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 9.5 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 32.3 bits (70), Expect = 0.005 Identities = 25/79 (31%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 357 PVEKKTPYPVKVLVPQP--YPXCQTCPLPS*RDCQGTSSRTATLPSRKEGALPSTCPSRQ 530 PV+ P K QP +P C S R G S RT + +K GA + + Sbjct: 171 PVDLSKSEPEKKTESQPMLWPAWVYCTRYSDRPSSGRSPRTRRV--KKPGAKQGAPTAEE 228 Query: 531 TRPRQGICARTLPRLKRKF 587 RPR L RLK +F Sbjct: 229 KRPRTAFSGAQLARLKHEF 247 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 38 NLLVQHHETNARGRQ 82 N+L++HHE A G Q Sbjct: 113 NMLLRHHEEVADGHQ 127 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 38 NLLVQHHETNARGRQ 82 N+L++HHE A G Q Sbjct: 113 NMLLRHHEEVADGHQ 127 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 38 NLLVQHHETNARGRQ 82 N+L++HHE A G Q Sbjct: 113 NMLLRHHEEVADGHQ 127 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +1 Query: 769 PRSRNPVPYPGXKTXCPTP 825 PR + P PY G P P Sbjct: 393 PRDKAPSPYGGQMFEAPIP 411 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,409 Number of Sequences: 336 Number of extensions: 2802 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23893023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -