BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F04 (873 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 24 5.3 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 23 9.2 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 24.2 bits (50), Expect = 5.3 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +3 Query: 582 YPPMDHVSEYSDLXHVPSRGLLHATSTLHARTLRLNII 695 +P H E L H+P+ L+ + HA T+ ++ Sbjct: 465 HPGAIHTDELPYLFHIPAAMLVPVSPDSHANTVSSRVV 502 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +2 Query: 650 CDVDA-PRPYSSSEYY-PWNKWFTGA 721 C V+ P Y++ +Y PW K +TGA Sbjct: 380 CGVEGLPGVYTNVHHYLPWIKMYTGA 405 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 943,853 Number of Sequences: 2352 Number of extensions: 21417 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93439926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -