BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F04 (873 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB051521-1|BAB21825.1| 1313|Homo sapiens KIAA1734 protein protein. 66 1e-10 >AB051521-1|BAB21825.1| 1313|Homo sapiens KIAA1734 protein protein. Length = 1313 Score = 66.5 bits (155), Expect = 1e-10 Identities = 34/100 (34%), Positives = 58/100 (58%) Frame = +1 Query: 217 EANSSDQESDIETPIQKGEIRVVWHPSGTERVISEKSVGLADRSLMPGDVVRRLIAGKDT 396 EA + E +P+++G +RV W+P G ++ + E + L DRS++P DVVR + D+ Sbjct: 124 EAGGAGHEEGRASPLRRGYVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHM-RSTDS 182 Query: 397 QRGYCRDIVMTAALQIVGTKHVIPSVASERLQPLEEFSPG 516 Q G D+ + A++++GT +I V S+ LQ + F G Sbjct: 183 QCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYG 222 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,508,953 Number of Sequences: 237096 Number of extensions: 3186195 Number of successful extensions: 6475 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6474 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11104084400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -