BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F04 (873 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 4.9 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 6.4 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 6.4 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 6.4 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 8.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 8.5 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 4.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 381 RWQGYPEGILPRHCNDGRLADRGHETRDPQ 470 RW Y E + P CN G A ++RDP+ Sbjct: 394 RWFTYQETVDPAGCNAGP-AKYYLKSRDPE 422 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 6.4 Identities = 8/37 (21%), Positives = 15/37 (40%) Frame = +2 Query: 257 LYKKEKFVLYGILPAQNALYLRNRWVWQTGPLCQVMW 367 L+ F +Y L N +++ + W + V W Sbjct: 470 LHNSSPFSIYSFLERLNLIFMSSSLQWSSTHTLDVAW 506 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 6.4 Identities = 8/37 (21%), Positives = 15/37 (40%) Frame = +2 Query: 257 LYKKEKFVLYGILPAQNALYLRNRWVWQTGPLCQVMW 367 L+ F +Y L N +++ + W + V W Sbjct: 508 LHNSSPFSIYSFLERLNLIFMSSSLQWSSTHTLDVAW 544 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 6.4 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 636 ERARVLGLNTPRRD-PSEDTKRSLLWTALE 550 +RA LG++TP++D P++ L AL+ Sbjct: 446 QRAHRLGIDTPKKDGPTKSWSDESLNNALD 475 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 8.5 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 287 HTTRISPFCIGVSMSLSWSL 228 H T+I+ C+ +S+S + +L Sbjct: 733 HETQITTLCVAISLSATVTL 752 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 8.5 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 287 HTTRISPFCIGVSMSLSWSL 228 H T+I+ C+ +S+S + +L Sbjct: 823 HETQITTLCVAISLSATVTL 842 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 249,054 Number of Sequences: 438 Number of extensions: 5905 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28280841 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -