BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F03 (858 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical pr... 33 0.34 AF067609-11|AAC17532.2| 252|Caenorhabditis elegans Hypothetical... 28 7.4 Z75531-12|CAA99806.4| 348|Caenorhabditis elegans Hypothetical p... 28 9.8 AC024877-2|AAF60905.2| 608|Caenorhabditis elegans Hypothetical ... 28 9.8 >Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical protein F28D9.1 protein. Length = 601 Score = 32.7 bits (71), Expect = 0.34 Identities = 33/121 (27%), Positives = 51/121 (42%), Gaps = 1/121 (0%) Frame = +2 Query: 431 RIQSRNTSPIPSRRKYPMR*KCPYLSPTPSKRKFPLPSRNTSNTQYTYLNLTPLKRKYXX 610 R +SR+ SP RR+ P K P P P +R+ P SR+ + + + P +R+ Sbjct: 363 RAKSRSKSPPARRRRSPSASKSP---PAPRRRRSPSKSRSPAPKR----EIPPARRRRSP 415 Query: 611 XXXXXXXXXXXXXXXCPLP-TPLRRKSLTK*KCPFPXPTLSRKRSXFQ*NXKLRCPNHTK 787 P P RR+S ++ K P P S +S Q + R P+ +K Sbjct: 416 SASKSPPAPKRAKSRSKSPPAPRRRRSPSQSKSPAPRRRRSPSKSP-QAPRRRRSPSGSK 474 Query: 788 S 790 S Sbjct: 475 S 475 >AF067609-11|AAC17532.2| 252|Caenorhabditis elegans Hypothetical protein C23H5.1 protein. Length = 252 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 708 GHFHFVRDFLLNGVGSGHFDFDFVR 634 GH ++ L G G+GH+ FDF+R Sbjct: 32 GHILVGKEVLDVGCGNGHYSFDFLR 56 >Z75531-12|CAA99806.4| 348|Caenorhabditis elegans Hypothetical protein C54D10.6 protein. Length = 348 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -1 Query: 204 VAFIATSEIMSSIRSYVIDAPFVLFLLFDCLRCAFLLLG 88 + IAT ++S+I + ++ P+ +F C RC + G Sbjct: 283 LCLIATHGLLSTITTIMVHKPYRVFFFILCRRCLLMPAG 321 >AC024877-2|AAF60905.2| 608|Caenorhabditis elegans Hypothetical protein Y95B8A.7 protein. Length = 608 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 431 RIQSRNTSPIPSRRKYPMR*KCPYLSP-TPSKRKFPLPSRNTSNTQYTYLN 580 R Q + + +P+ + P K P+ +P P R+F + T N +Y LN Sbjct: 221 RSQEKRKNQLPAVHEPPSFMKTPWFAPPAPEGREFNIVDDRTINEKYAGLN 271 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,893,486 Number of Sequences: 27780 Number of extensions: 267384 Number of successful extensions: 793 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 791 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2139963672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -