BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_F01 (826 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31F12.01 |zds1|SPAC637.14, mug88|zds family protein Zds1|Sch... 26 7.5 SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ... 25 9.9 SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces po... 25 9.9 SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces pombe... 25 9.9 >SPAC31F12.01 |zds1|SPAC637.14, mug88|zds family protein Zds1|Schizosaccharomyces pombe|chr 1|||Manual Length = 938 Score = 25.8 bits (54), Expect = 7.5 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 328 LPRRKAHPLPGRKENPLPRESARSPT-LPRLSNMSLTQLKR 447 +P R P+PGR +P P R PT +P N+SL K+ Sbjct: 588 IPPRVPTPVPGRTLSPKP---TRIPTPIPSSLNVSLESSKK 625 >SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 25.4 bits (53), Expect = 9.9 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 316 SSRSLPRRKAHPL-PGRKENPLPRESARSPTLP 411 S R +P+ P P + +PLP S R +LP Sbjct: 14 SERMVPQVNTSPFAPAQSSSPLPSNSCREYSLP 46 >SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 25.4 bits (53), Expect = 9.9 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +1 Query: 322 RSLPRRKAHPLPGRKENPLPRE-SARSPTLPRLSNMSLTQLKRLSRYQFTYRNPTQSKRR 498 RSL K++PLP + + L R S++ T + + T L L + R P R Sbjct: 479 RSLNNTKSNPLPAKSIDSLERALSSKKITDTEKNELLETCLSILDSWSLAERFPALDALR 538 Query: 499 CLTQYMSQSTDPSP 540 L ++ S+D +P Sbjct: 539 LLA--INSSSDLAP 550 >SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 570 Score = 25.4 bits (53), Expect = 9.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 367 LFYRVGDVLFDGVGNGNFLNDSY 299 L +VGD F VGN N LN +Y Sbjct: 38 LIEKVGDETFRWVGNENELNGAY 60 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,287,214 Number of Sequences: 5004 Number of extensions: 39309 Number of successful extensions: 113 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 404442380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -