BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E20 (853 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC359.02 |alr2||alanine racemase Alr2 |Schizosaccharomyces pom... 27 3.4 SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase G... 27 3.4 SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pomb... 27 4.5 >SPBC359.02 |alr2||alanine racemase Alr2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 370 Score = 27.1 bits (57), Expect = 3.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 465 QAPWLPPPIFPSFKVADEAVKXLHAEED 548 +AP LP P+ P+ K+ V H E+D Sbjct: 234 KAPELPKPLIPAMKLMSTIVCVKHVEKD 261 >SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase Gde1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 27.1 bits (57), Expect = 3.4 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -1 Query: 703 NPPLFIXXXXXXXXXPAKIATEKTALRWYNA-SFLTLISLCTPLV 572 NP LF+ + A+ + AL++ + SFL ++S C PL+ Sbjct: 970 NPVLFLTEGGTAYRTDVRAASLRQALKFASQWSFLGIVSACEPLI 1014 >SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 657 Score = 26.6 bits (56), Expect = 4.5 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 Query: 504 KVADEAVKXLHAEED*DVVDPRPTKGVHKEMRVKKEALYH 623 +V D A + H+E + DP KGVH MR AL H Sbjct: 385 EVPDTASETEHSEIEDFHFDPYSEKGVHIAMRYFDAALTH 424 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,476,721 Number of Sequences: 5004 Number of extensions: 37790 Number of successful extensions: 109 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -