BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E19 (860 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 4.8 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 4.8 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 4.8 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 4.8 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 4.8 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 4.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 695 LVPGDERTPXKXTXPPXSP 751 +V GD TP K PP P Sbjct: 330 IVLGDSDTPPKPAPPPPPP 348 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 4.8 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 401 VGCKCP*NLFPGPKGDSGRGSLGSTPRSDSDEEADAVEHL 520 V C P P + +SGR TPR +S + D + Sbjct: 390 VACSPPPRQTPPSRKESGRRRRRRTPRYNSVSKIDRASRI 429 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 4.8 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 437 PKGDSGRGSLGSTPRSDSDEE-ADAVEHL 520 PK S G+L +T +DEE A A +HL Sbjct: 358 PKAHSKGGTLENTINGRADEEAAPAPQHL 386 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 4.8 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 437 PKGDSGRGSLGSTPRSDSDEE-ADAVEHL 520 PK S G+L +T +DEE A A +HL Sbjct: 358 PKAHSKGGTLENTINGRADEEAAPAPQHL 386 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.6 bits (46), Expect = 4.8 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 437 PKGDSGRGSLGSTPRSDSDEE-ADAVEHL 520 PK S G+L +T +DEE A A +HL Sbjct: 296 PKAHSKGGTLENTINGRADEEAAPAPQHL 324 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,226 Number of Sequences: 438 Number of extensions: 4845 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -