BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E18 (883 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC8E4.05c |||fumarate lyase superfamily|Schizosaccharomyces po... 29 1.2 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 29 1.2 SPAC22F8.12c |shf1||small histone ubiquitination factor Shf1|Sch... 28 1.5 SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces... 27 2.7 SPAC23H4.02 |ppk9||serine/threonine protein kinase Ppk9 |Schizos... 27 3.5 SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar... 27 4.7 SPAC8F11.03 |msh3|swi4|MutS protein homolog 3|Schizosaccharomyce... 27 4.7 >SPBC8E4.05c |||fumarate lyase superfamily|Schizosaccharomyces pombe|chr 2|||Manual Length = 447 Score = 28.7 bits (61), Expect = 1.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 190 LTTRKLAERLGVQQPALYWHFRNKR 264 + +KLAE LG+ QP + WH R Sbjct: 210 MVQQKLAEELGLLQPEIAWHTERDR 234 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 627 VQLCHTTEVRFLHKDPKLAV-FPVTTL*ND 541 + LCH + L DPKLAV FP ++ ND Sbjct: 1109 IALCHNKGIDVLRLDPKLAVGFPSPSVLND 1138 >SPAC22F8.12c |shf1||small histone ubiquitination factor Shf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 165 Score = 28.3 bits (60), Expect = 1.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 807 QGSFQAPQSSQSXHDHNQPYH 869 + S+ +P SS + +HN PYH Sbjct: 49 RSSYDSPSSSTNSKEHNSPYH 69 >SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1009 Score = 27.5 bits (58), Expect = 2.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 29 LCDIHCAWRGFFITDKLVDILC 94 +C + WR F TD +VDI+C Sbjct: 479 ICQLAADWRKAFKTDVVVDIVC 500 >SPAC23H4.02 |ppk9||serine/threonine protein kinase Ppk9 |Schizosaccharomyces pombe|chr 1|||Manual Length = 532 Score = 27.1 bits (57), Expect = 3.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 660 KYKIFKCIMC*TSCICLLLE 719 KYK+F CI C S + L++E Sbjct: 468 KYKVFSCITCHNSPVYLVIE 487 >SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosaccharomyces pombe|chr 3|||Manual Length = 902 Score = 26.6 bits (56), Expect = 4.7 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +3 Query: 354 DRECPQLQAGAARLPPAQWHHVLELQVAAALEYPSRGPSL--RVPSFLVQSGPYSES 518 D+ P LQ ++LP QW ++ L+ A P P + + P FL SE+ Sbjct: 699 DQLDPNLQT-LSKLPRTQWQTLINLEAIKARNAPKEVPKVPEKAPFFLPSLKDQSEA 754 >SPAC8F11.03 |msh3|swi4|MutS protein homolog 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1004 Score = 26.6 bits (56), Expect = 4.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 543 DGQCLAYNTTHYRDHFVQESWVRVSLGPSRDTLER 439 DG+ ++Y HY + +++ + V+ PS LER Sbjct: 859 DGEAISYAVLHYLNQYIKSYLLFVTHFPSLGILER 893 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,357,277 Number of Sequences: 5004 Number of extensions: 63365 Number of successful extensions: 149 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 442483990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -