BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E17 (851 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 139 3e-35 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 139 3e-35 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 123 2e-30 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 25 1.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 25 1.0 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 3.1 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 4.1 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 4.1 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 9.4 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 139 bits (336), Expect = 3e-35 Identities = 64/78 (82%), Positives = 71/78 (91%) Frame = +3 Query: 609 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGED 788 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGED Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGED 60 Query: 789 FDNRMVNHFVQEFKRKXK 842 FDNR+V + Q+FK+K K Sbjct: 61 FDNRLVEYCTQDFKKKHK 78 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 139 bits (336), Expect = 3e-35 Identities = 64/78 (82%), Positives = 71/78 (91%) Frame = +3 Query: 609 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGED 788 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGED Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGED 60 Query: 789 FDNRMVNHFVQEFKRKXK 842 FDNR+V + Q+FK+K K Sbjct: 61 FDNRLVEYCTQDFKKKHK 78 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 123 bits (297), Expect = 2e-30 Identities = 54/79 (68%), Positives = 72/79 (91%) Frame = +3 Query: 609 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGED 788 INEPTAAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+FEV +T+GDTHLGGED Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATSGDTHLGGED 59 Query: 789 FDNRMVNHFVQEFKRKXKR 845 FD +++++F++ K+K K+ Sbjct: 60 FDQKVMDYFIKMVKQKHKK 78 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.6 bits (51), Expect = 1.0 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +1 Query: 106 RSRNRSGYHVLLRWCLPAREGGDHRQRPGXTGPLRLMLRSQ 228 + R R G +WC P R R GP RL RS+ Sbjct: 573 KCRARYGLDQQNQWCKPCRPREQLTWRRNFHGPHRLAARSR 613 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.6 bits (51), Expect = 1.0 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +1 Query: 106 RSRNRSGYHVLLRWCLPAREGGDHRQRPGXTGPLRLMLRSQ 228 + R R G +WC P R R GP RL RS+ Sbjct: 465 KCRARYGLDQQNQWCKPCRPREQLTWRRNFHGPHRLAARSR 505 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 3.1 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +3 Query: 381 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 506 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 564 TKDAGTISGLNVLRIINEPTAA 629 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.6 bits (46), Expect = 4.1 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +2 Query: 452 FH-GAYENEGNCRSL---SWQNCA---ECSYHGSRVLQ*LSKTSHKRCR 577 FH GA+ EG C+S ++ N + EC +G V+ ++T+ K CR Sbjct: 15 FHFGAFTCEG-CKSFFGRTYNNISSISECKNNGECVINKKNRTACKACR 62 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/61 (18%), Positives = 24/61 (39%) Frame = -1 Query: 815 KVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVS 636 K++ I KVL + +G + G + G +++D Y + + K + Sbjct: 210 KLLTSKIYKVLEEKYKTSGSLYTCWSEFTQKTQGQIYGIKVDIRDAYGNVKIPVLCKLIQ 269 Query: 635 N 633 + Sbjct: 270 S 270 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,049 Number of Sequences: 336 Number of extensions: 4437 Number of successful extensions: 16 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -