BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E17 (851 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 137 5e-34 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 32 0.025 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 3.9 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.9 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 3.9 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 6.7 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 6.7 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 8.9 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 137 bits (331), Expect = 5e-34 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = +3 Query: 513 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 692 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Query: 693 GGGTFDVSILTIEDG 737 GGGTFDVSILTI++G Sbjct: 61 GGGTFDVSILTIDEG 75 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 31.9 bits (69), Expect = 0.025 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 204 WSCXPWSLAMISTFPCWKTPTQEYVVPRSIPTAGAFA 94 W C WS+A T C +T E V+ RS P++ A Sbjct: 21 WDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLA 57 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.6 bits (51), Expect = 3.9 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +1 Query: 91 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPGXTGPLRLMLRS 225 +GK RS + +++LL P REG H+ Q PG G +R+ + + Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG--GAVRVTIEN 1846 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.9 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -2 Query: 772 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 674 W+ P T+ +P++ PPP + +T Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.9 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -2 Query: 772 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 674 W+ P T+ +P++ PPP + +T Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -2 Query: 772 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 674 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -2 Query: 772 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 674 W+ P T+ +P + PPP + +T Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 8.9 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%) Frame = -2 Query: 769 VSPAVDFTSKIPSSMVRMDTSKVPPP---RSKI---------STFRS-PVPF-LSRP*AI 632 +SP +F++ S++ ++ + PPP RSK T RS PVPF L+ P A Sbjct: 439 ISPPAEFSNGSSKSLLLLNGNGPPPPVPERSKTPNSIYLSQNGTPRSTPVPFALAPPPAA 498 Query: 631 AAAVGSLMIR 602 + A G +R Sbjct: 499 SPAFGDRSVR 508 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 907,572 Number of Sequences: 2352 Number of extensions: 18755 Number of successful extensions: 50 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90545769 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -