BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E13 (886 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 4.2 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 4.2 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 4.2 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 9.7 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.6 bits (46), Expect = 4.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -1 Query: 142 VFGCNFVMLDTLSLINIICPPNLSVIKNPRQQQWI 38 +F N + D + L+ +C P + V N R + W+ Sbjct: 105 IFLVNLSVADLMVLL--VCTPTVLVEVNSRPETWV 137 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.6 bits (46), Expect = 4.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -1 Query: 142 VFGCNFVMLDTLSLINIICPPNLSVIKNPRQQQWI 38 +F N + D + L+ +C P + V N R + W+ Sbjct: 105 IFLVNLSVADLMVLL--VCTPTVLVEVNSRPETWV 137 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.6 bits (46), Expect = 4.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 610 VV*HNWTNYLQRFKA 654 +V H W NY+ +F+A Sbjct: 401 MVSHKWLNYINQFEA 415 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -2 Query: 369 GHSRSEMSASRRRLSAPNAYDSPP 298 GH+ + + AS+ L +P++ +PP Sbjct: 258 GHAFTLVDASQHDLGSPSSGPAPP 281 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,215 Number of Sequences: 336 Number of extensions: 3164 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24513621 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -