BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E13 (886 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 4.9 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 22 6.5 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 22 6.5 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 8.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 8.6 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 4.9 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -3 Query: 545 DGQCLAYNTTHYRDHFVQESWVRVSLGPSRDTLERP 438 D Q Y + + V + VRV LGP D RP Sbjct: 514 DHQPYQYKIAVHSEQNVPGAVVRVFLGPKHDHQGRP 549 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 22.2 bits (45), Expect = 6.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 33 CDIHCCWRGF 62 CD+ CC RG+ Sbjct: 113 CDLMCCGRGY 122 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 22.2 bits (45), Expect = 6.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 33 CDIHCCWRGF 62 CD+ CC RG+ Sbjct: 114 CDLMCCGRGY 123 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 112 TLSLINIICPPNLSVIKNPRQQQ 44 TL+ + CPPNL + +Q Sbjct: 304 TLNATTLFCPPNLRLTSERGYEQ 326 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 112 TLSLINIICPPNLSVIKNPRQQQ 44 TL+ + CPPNL + +Q Sbjct: 394 TLNATTLFCPPNLRLTSERGYEQ 416 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,836 Number of Sequences: 438 Number of extensions: 3886 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28766349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -