BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E09 (843 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB032251-1|BAA89208.1| 2781|Homo sapiens bromodomain PHD finger ... 31 6.9 U28686-1|AAB17212.1| 157|Homo sapiens RNPL protein. 30 9.1 BC006825-1|AAH06825.1| 157|Homo sapiens RNA binding motif (RNP1... 30 9.1 AY282495-1|AAP22284.1| 2764|Homo sapiens bromodomain PHD finger ... 30 9.1 >AB032251-1|BAA89208.1| 2781|Homo sapiens bromodomain PHD finger transcription factor protein. Length = 2781 Score = 30.7 bits (66), Expect = 6.9 Identities = 19/44 (43%), Positives = 29/44 (65%) Frame = +3 Query: 555 SRTDSSQLRLVDPKHNPIEDNKLLHPLDQQVDPLNTDSRTPETE 686 S++DSS LR+ DP H NK L+P D+ +D ++ R+PET+ Sbjct: 1002 SQSDSSVLRMSDPSHT---TNK-LYPKDRVLDDVSI--RSPETK 1039 >U28686-1|AAB17212.1| 157|Homo sapiens RNPL protein. Length = 157 Score = 30.3 bits (65), Expect = 9.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -2 Query: 215 FHTRKHSGMVRLECFGPVCELIVLKPAQRSQSQAF*FAPFVN 90 F+T + + FGP+ E++V+K + +S+ F F F N Sbjct: 15 FNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTN 56 >BC006825-1|AAH06825.1| 157|Homo sapiens RNA binding motif (RNP1, RRM) protein 3 protein. Length = 157 Score = 30.3 bits (65), Expect = 9.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -2 Query: 215 FHTRKHSGMVRLECFGPVCELIVLKPAQRSQSQAF*FAPFVN 90 F+T + + FGP+ E++V+K + +S+ F F F N Sbjct: 15 FNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTN 56 >AY282495-1|AAP22284.1| 2764|Homo sapiens bromodomain PHD finger transcription factor protein. Length = 2764 Score = 30.3 bits (65), Expect = 9.1 Identities = 19/44 (43%), Positives = 28/44 (63%) Frame = +3 Query: 555 SRTDSSQLRLVDPKHNPIEDNKLLHPLDQQVDPLNTDSRTPETE 686 S +DSS LR+ DP H NK L+P D+ +D ++ R+PET+ Sbjct: 1128 SESDSSVLRMSDPSHT---TNK-LYPKDRVLDDVSI--RSPETK 1165 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,099,899 Number of Sequences: 237096 Number of extensions: 2301704 Number of successful extensions: 5268 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5268 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10649685938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -