Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP01_FL5_E05
         (854 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   3.1  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    23   4.1  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +3

Query: 702  PSNPVPPNLTTGV 740
            P  P PP +TTGV
Sbjct: 1009 PVTPAPPQVTTGV 1021


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = -1

Query: 242 FTEYVL*FLFCGFVWYITHENRSHGFIHDALFLFFFTFIHLYNCML 105
           FT ++L  L C + +Y  H      FI   + L F   I+ + C L
Sbjct: 248 FTVHLL-LLVCIYYFYYMHLLFCCAFIIFTMHLLFLLCIYYFYCAL 292


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 192,664
Number of Sequences: 336
Number of extensions: 4199
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23659332
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)