BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E02 (845 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 6.7 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 23 8.8 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 23 8.8 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 411 QQRSYWFGCEVQQGSRHCHSRR 476 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.4 bits (48), Expect = 8.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -1 Query: 626 IPVPRGAGISRTVTEPHLPVTLQGTVCGFPILLPQ*PLRTGRTD 495 + +P +T+ E + QGTVC F + + TG D Sbjct: 35 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTYREMGILTGVDD 78 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.4 bits (48), Expect = 8.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -1 Query: 626 IPVPRGAGISRTVTEPHLPVTLQGTVCGFPILLPQ*PLRTGRTD 495 + +P +T+ E + QGTVC F + + TG D Sbjct: 184 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTYREMGILTGVDD 227 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 800,423 Number of Sequences: 2352 Number of extensions: 15866 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -