BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E01 (861 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 47 7e-04 UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma j... 42 0.026 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 41 0.035 UniRef50_Q17R98 Cluster: LOC152485 protein; n=42; Euteleostomi|R... 41 0.035 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 41 0.046 UniRef50_O97214 Cluster: Putative uncharacterized protein L4830.... 31 0.049 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 40 0.061 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 40 0.081 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 40 0.081 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 40 0.081 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 34 0.087 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 40 0.11 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 40 0.11 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 40 0.11 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 40 0.11 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 39 0.14 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 39 0.14 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 39 0.14 UniRef50_A4RW22 Cluster: Predicted protein; n=1; Ostreococcus lu... 39 0.14 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 39 0.14 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 39 0.14 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 39 0.19 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 39 0.19 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 39 0.19 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 39 0.19 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 39 0.19 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 39 0.19 UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: K... 39 0.19 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 39 0.19 UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endo... 38 0.25 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 38 0.25 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 38 0.25 UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus... 38 0.25 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 38 0.25 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 38 0.25 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 38 0.25 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 38 0.25 UniRef50_Q01HW3 Cluster: B0616E02-H0507E05.9 protein; n=4; Oryza... 38 0.25 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 38 0.25 UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis... 38 0.25 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 38 0.25 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 38 0.25 UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 38 0.25 UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.25 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.25 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 38 0.25 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 38 0.25 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 38 0.25 UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family... 38 0.25 UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n... 38 0.33 UniRef50_Q1MDU0 Cluster: Putative proline rich protein; n=1; Rhi... 38 0.33 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 38 0.33 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 38 0.33 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 38 0.33 UniRef50_Q8LJ87 Cluster: Putative leucine-rich repeat/extensin 1... 38 0.33 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 38 0.33 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 38 0.33 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 38 0.33 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 38 0.33 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 38 0.33 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 38 0.33 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 38 0.33 UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n... 38 0.43 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 38 0.43 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 38 0.43 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 38 0.43 UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rho... 38 0.43 UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas ne... 38 0.43 UniRef50_A4TTL3 Cluster: Putative uncharacterized protein; n=2; ... 38 0.43 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 38 0.43 UniRef50_Q8LG30 Cluster: Adhesive/proline-rich-like protein; n=7... 38 0.43 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 38 0.43 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 38 0.43 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 38 0.43 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 38 0.43 UniRef50_A5C4F9 Cluster: Putative uncharacterized protein; n=1; ... 38 0.43 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 38 0.43 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 38 0.43 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 38 0.43 UniRef50_A1Z6X9 Cluster: CG11112-PB, isoform B; n=2; Drosophila ... 38 0.43 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 38 0.43 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 38 0.43 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 38 0.43 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 38 0.43 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 38 0.43 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 38 0.43 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 38 0.43 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 38 0.43 UniRef50_UPI0000E4A1BC Cluster: PREDICTED: similar to myosin XV;... 37 0.57 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 37 0.57 UniRef50_UPI0000DB6BDB Cluster: PREDICTED: similar to prickle CG... 37 0.57 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 37 0.57 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 37 0.57 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 37 0.57 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 37 0.57 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 37 0.57 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 37 0.57 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 37 0.57 UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|R... 37 0.57 UniRef50_Q94273 Cluster: Ground-like (Grd related) protein 6; n=... 37 0.57 UniRef50_Q4QPX2 Cluster: IP05560p; n=1; Drosophila melanogaster|... 37 0.57 UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; ... 37 0.57 UniRef50_Q9C0F0 Cluster: Protein KIAA1713; n=33; Deuterostomia|R... 37 0.57 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 37 0.57 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 37 0.57 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 37 0.57 UniRef50_A2EKU5 Cluster: Putative uncharacterized protein; n=1; ... 31 0.73 UniRef50_UPI0000F2E28C Cluster: PREDICTED: similar to high-mobil... 37 0.75 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 37 0.75 UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein;... 37 0.75 UniRef50_Q653X1 Cluster: Putative uncharacterized protein P0547F... 37 0.75 UniRef50_Q9W2R5 Cluster: CG15225-PA; n=1; Drosophila melanogaste... 37 0.75 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 37 0.75 UniRef50_Q7PUD2 Cluster: ENSANGP00000013887; n=2; Culicidae|Rep:... 37 0.75 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 37 0.75 UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella ve... 37 0.75 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 37 0.75 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 37 0.75 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 37 0.75 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 37 0.75 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 37 0.75 UniRef50_A5DP36 Cluster: Putative uncharacterized protein; n=1; ... 37 0.75 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 37 0.75 UniRef50_O60885 Cluster: Bromodomain-containing protein 4; n=70;... 37 0.75 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 36 1.00 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 36 1.00 UniRef50_UPI0000DB7D01 Cluster: PREDICTED: similar to Wiskott-Al... 36 1.00 UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009;... 36 1.00 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 36 1.00 UniRef50_Q117D5 Cluster: Putative uncharacterized protein precur... 36 1.00 UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Ara... 36 1.00 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 36 1.00 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 36 1.00 UniRef50_Q4QH65 Cluster: Putative uncharacterized protein; n=3; ... 36 1.00 UniRef50_A2E6V2 Cluster: WH2 motif family protein; n=3; Trichomo... 36 1.00 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 36 1.00 UniRef50_Q4UMI6 Cluster: Arp2/3 complex-activating protein rickA... 36 1.00 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 36 1.3 UniRef50_UPI000023F6A5 Cluster: hypothetical protein FG10389.1; ... 36 1.3 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 36 1.3 UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whol... 36 1.3 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 36 1.3 UniRef50_A6G312 Cluster: Serine/threonine protein kinase; n=1; P... 36 1.3 UniRef50_A5UZG1 Cluster: Protein kinase; n=4; Chloroflexaceae|Re... 36 1.3 UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; ... 36 1.3 UniRef50_Q8RXR4 Cluster: Putative uncharacterized protein At4g14... 36 1.3 UniRef50_O23331 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_Q9VSQ1 Cluster: CG32030-PA, isoform A; n=9; Endopterygo... 36 1.3 UniRef50_Q5C113 Cluster: SJCHGC03128 protein; n=4; Eukaryota|Rep... 36 1.3 UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_Q1HMI9 Cluster: Formin C; n=3; Trypanosoma cruzi|Rep: F... 36 1.3 UniRef50_A2FFZ7 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_Q8WZK9 Cluster: Putative uncharacterized protein B14D6.... 36 1.3 UniRef50_A7ER22 Cluster: Predicted protein; n=1; Sclerotinia scl... 36 1.3 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 36 1.3 UniRef50_Q00486 Cluster: Mini-collagen precursor; n=2; Hydra sp.... 28 1.3 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 36 1.7 UniRef50_UPI000023DB29 Cluster: hypothetical protein FG02238.1; ... 36 1.7 UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n... 36 1.7 UniRef50_Q6NXC1 Cluster: Zgc:56141; n=4; Clupeocephala|Rep: Zgc:... 36 1.7 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 36 1.7 UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 36 1.7 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 36 1.7 UniRef50_Q0JDV1 Cluster: Os04g0373000 protein; n=2; Magnoliophyt... 36 1.7 UniRef50_Q013S1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 36 1.7 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 36 1.7 UniRef50_Q7JRM9 Cluster: GH11283p; n=20; Eumetazoa|Rep: GH11283p... 36 1.7 UniRef50_Q5BZA5 Cluster: SJCHGC07445 protein; n=1; Schistosoma j... 36 1.7 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 36 1.7 UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; ... 36 1.7 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 36 1.7 UniRef50_A0CNK9 Cluster: Chromosome undetermined scaffold_22, wh... 36 1.7 UniRef50_Q2H9M3 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_A4RAI7 Cluster: Predicted protein; n=1; Magnaporthe gri... 36 1.7 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 36 1.7 UniRef50_A3GHT1 Cluster: Predicted protein; n=3; Saccharomycetac... 36 1.7 UniRef50_A2R7D2 Cluster: Contig An16c0100, complete genome; n=1;... 36 1.7 UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Pro... 36 1.7 UniRef50_A5DQ05 Cluster: Putative uncharacterized protein; n=1; ... 27 1.9 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 35 2.3 UniRef50_UPI00015B5935 Cluster: PREDICTED: similar to prIL-16; n... 35 2.3 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 35 2.3 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 35 2.3 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 35 2.3 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 35 2.3 UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, peripla... 35 2.3 UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; ... 35 2.3 UniRef50_A3WE37 Cluster: Putative uncharacterized protein; n=2; ... 35 2.3 UniRef50_A2SK16 Cluster: Putative uncharacterized protein; n=1; ... 35 2.3 UniRef50_A0M294 Cluster: BlaR1-like family M56 peptidase; n=1; G... 35 2.3 UniRef50_A0J0A0 Cluster: Putative lipoprotein precursor; n=2; Al... 35 2.3 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 35 2.3 UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhar... 35 2.3 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 35 2.3 UniRef50_Q01B16 Cluster: Chromosome 04 contig 1, DNA sequence; n... 35 2.3 UniRef50_A5B8N9 Cluster: Putative uncharacterized protein; n=1; ... 35 2.3 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 35 2.3 UniRef50_Q2GVY3 Cluster: Putative uncharacterized protein; n=2; ... 35 2.3 UniRef50_P33485 Cluster: Probable nuclear antigen; n=5; root|Rep... 35 2.3 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 35 2.3 UniRef50_A4FBY5 Cluster: Putative uncharacterized protein; n=1; ... 31 2.7 UniRef50_UPI0000F2D09F Cluster: PREDICTED: hypothetical protein;... 35 3.0 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 35 3.0 UniRef50_UPI0000F2B0FD Cluster: PREDICTED: similar to peroxisome... 35 3.0 UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein;... 35 3.0 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 35 3.0 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 35 3.0 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 35 3.0 UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropica... 35 3.0 UniRef50_Q3V4U6 Cluster: Putative uncharacterized protein; n=1; ... 35 3.0 UniRef50_Q8XTG7 Cluster: Probable prolin-rich transmembrane prot... 35 3.0 UniRef50_Q5YRU1 Cluster: Putative serine/threonine protein kinas... 35 3.0 UniRef50_A0L6N7 Cluster: Putative uncharacterized protein precur... 35 3.0 UniRef50_A0ADW6 Cluster: Putative secreted proline-rich protein;... 35 3.0 UniRef50_Q9XIP3 Cluster: Putative uncharacterized protein At2g27... 35 3.0 UniRef50_Q9XIB6 Cluster: F13F21.7 protein; n=5; core eudicotyled... 35 3.0 UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Re... 35 3.0 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 35 3.0 UniRef50_Q9FJX6 Cluster: Formin-like protein; n=1; Arabidopsis t... 35 3.0 UniRef50_Q6NMD9 Cluster: At1g02405; n=1; Arabidopsis thaliana|Re... 35 3.0 UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En... 35 3.0 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 35 3.0 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 35 3.0 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 35 3.0 UniRef50_Q10MK2 Cluster: Glycosyltransferase 5, putative, expres... 35 3.0 UniRef50_Q9VEP4 Cluster: CG5225-PA; n=2; Drosophila melanogaster... 35 3.0 UniRef50_Q9VC76 Cluster: CG13615-PA; n=2; Sophophora|Rep: CG1361... 35 3.0 UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gamb... 35 3.0 UniRef50_Q4QIK8 Cluster: Putative uncharacterized protein; n=2; ... 35 3.0 UniRef50_Q4DD93 Cluster: Putative uncharacterized protein; n=3; ... 35 3.0 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 35 3.0 UniRef50_A7TDC9 Cluster: Predicted protein; n=1; Nematostella ve... 35 3.0 UniRef50_A2D8Z8 Cluster: Putative uncharacterized protein; n=1; ... 35 3.0 UniRef50_Q871Q2 Cluster: Putative uncharacterized protein B11C21... 35 3.0 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 35 3.0 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 35 3.0 UniRef50_A6QY38 Cluster: Predicted protein; n=1; Ajellomyces cap... 35 3.0 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 35 3.0 UniRef50_A0JLT2 Cluster: Mediator of RNA polymerase II transcrip... 35 3.0 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 35 3.0 UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana taba... 35 3.0 UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Pr... 35 3.0 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 35 3.0 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 35 3.0 UniRef50_A4R2D8 Cluster: Putative uncharacterized protein; n=1; ... 29 3.3 UniRef50_A7QDU5 Cluster: Chromosome chr4 scaffold_83, whole geno... 31 3.5 UniRef50_Q6Z4V0 Cluster: Putative AP2/EREBP transcription factor... 28 3.8 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 34 4.0 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 34 4.0 UniRef50_UPI0000F2E662 Cluster: PREDICTED: similar to CBLL1 prot... 34 4.0 UniRef50_UPI0000F2D497 Cluster: PREDICTED: similar to Proline-ri... 34 4.0 UniRef50_UPI0000EBD44D Cluster: PREDICTED: hypothetical protein;... 34 4.0 UniRef50_UPI0000D56E18 Cluster: PREDICTED: hypothetical protein;... 34 4.0 UniRef50_UPI00006A1088 Cluster: WAS/WASL interacting protein fam... 34 4.0 UniRef50_Q4SHS7 Cluster: Chromosome 5 SCAF14581, whole genome sh... 34 4.0 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 34 4.0 UniRef50_Q4RJJ1 Cluster: Chromosome 3 SCAF15037, whole genome sh... 34 4.0 UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; N... 34 4.0 UniRef50_Q8R2W2 Cluster: BC053440 protein; n=17; Eutheria|Rep: B... 34 4.0 UniRef50_Q3UHZ5 Cluster: 17 days embryo heart cDNA, RIKEN full-l... 34 4.0 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 34 4.0 UniRef50_Q5FQC0 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_Q2W2R6 Cluster: Trypsin-like serine protease,; n=2; Mag... 34 4.0 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 34 4.0 UniRef50_Q2W1I3 Cluster: Submaxillary gland androgen regulated p... 34 4.0 UniRef50_O69740 Cluster: CONSERVED HYPOTHETICAL PROLINE AND ALAN... 34 4.0 UniRef50_Q3W5H0 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_A5KRM5 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 34 4.0 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 34 4.0 UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa... 34 4.0 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 34 4.0 UniRef50_O48682 Cluster: F3I6.8 protein; n=2; Arabidopsis thalia... 34 4.0 UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliop... 34 4.0 UniRef50_A5BPY4 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 34 4.0 UniRef50_Q8IRB3 Cluster: CG32241-PA; n=1; Drosophila melanogaste... 34 4.0 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 34 4.0 UniRef50_Q54PI9 Cluster: Formin homology domain-containing prote... 34 4.0 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 34 4.0 UniRef50_Q4DNA6 Cluster: Mucin-associated surface protein (MASP)... 34 4.0 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 34 4.0 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 34 4.0 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 34 4.0 UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_A6NP65 Cluster: Uncharacterized protein CABLES2; n=1; H... 34 4.0 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 34 4.0 UniRef50_Q7RYA6 Cluster: Predicted protein; n=1; Neurospora cras... 34 4.0 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 34 4.0 UniRef50_Q5A044 Cluster: Potential mitochondrial protein Fmp13; ... 34 4.0 UniRef50_Q2UL57 Cluster: CDK9 kinase-activating protein cyclin T... 34 4.0 UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 34 4.0 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 34 4.0 UniRef50_Q9BTV7 Cluster: CDK5 and ABL1 enzyme substrate 2; n=7; ... 34 4.0 UniRef50_A4HRG9 Cluster: Putative uncharacterized protein; n=3; ... 31 4.3 UniRef50_Q2HEH6 Cluster: Putative uncharacterized protein; n=1; ... 27 4.5 UniRef50_Q1GR65 Cluster: Putative uncharacterized protein precur... 28 4.8 UniRef50_UPI00015B5B2E Cluster: PREDICTED: similar to ENSANGP000... 34 5.3 UniRef50_UPI00015B5140 Cluster: PREDICTED: similar to transcript... 34 5.3 UniRef50_UPI0000EBD1A6 Cluster: PREDICTED: hypothetical protein;... 34 5.3 UniRef50_UPI0000E4A721 Cluster: PREDICTED: similar to LOC397922 ... 34 5.3 UniRef50_UPI0000DB6C04 Cluster: PREDICTED: similar to scratch CG... 34 5.3 UniRef50_UPI0000DA22D1 Cluster: PREDICTED: hypothetical protein;... 34 5.3 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 34 5.3 UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to... 34 5.3 UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 ... 34 5.3 UniRef50_Q4S827 Cluster: Chromosome 9 SCAF14710, whole genome sh... 34 5.3 UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome s... 34 5.3 UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome... 34 5.3 UniRef50_Q197B3 Cluster: Putative uncharacterized protein; n=1; ... 34 5.3 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 34 5.3 UniRef50_Q2RTE8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.3 UniRef50_A6G9B3 Cluster: Putative uncharacterized protein; n=1; ... 34 5.3 UniRef50_A5V8M1 Cluster: OmpA/MotB domain protein precursor; n=3... 34 5.3 UniRef50_A0Y068 Cluster: TonB2 protein; n=1; Alteromonadales bac... 34 5.3 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 34 5.3 UniRef50_Q9M252 Cluster: Putative uncharacterized protein F7M19_... 34 5.3 UniRef50_Q9FLQ6 Cluster: Similarity to unknown protein; n=2; Ara... 34 5.3 UniRef50_Q8S9B6 Cluster: PR-1 like protein; n=1; Volvox carteri ... 34 5.3 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 34 5.3 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 34 5.3 UniRef50_Q3E939 Cluster: Uncharacterized protein At5g26080.1; n=... 34 5.3 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 34 5.3 UniRef50_Q0DHA1 Cluster: Os05g0481000 protein; n=1; Oryza sativa... 34 5.3 UniRef50_Q0D4Y0 Cluster: Os07g0598100 protein; n=1; Oryza sativa... 34 5.3 UniRef50_Q01942 Cluster: Extensin; n=22; root|Rep: Extensin - So... 34 5.3 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 34 5.3 UniRef50_A5D7V0 Cluster: MGC148775 protein; n=4; Theria|Rep: MGC... 34 5.3 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 34 5.3 UniRef50_Q9TYU9 Cluster: Temporarily assigned gene name protein ... 34 5.3 UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaste... 34 5.3 UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057... 34 5.3 UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.3 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 34 5.3 UniRef50_Q4D508 Cluster: Putative uncharacterized protein; n=2; ... 34 5.3 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 34 5.3 UniRef50_A0DUX8 Cluster: Chromosome undetermined scaffold_65, wh... 34 5.3 UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, wh... 34 5.3 UniRef50_Q872W5 Cluster: Putative uncharacterized protein B2G14.... 34 5.3 UniRef50_Q5BEN1 Cluster: Adenylyl cyclase-associated protein; n=... 34 5.3 UniRef50_Q2HGD8 Cluster: Predicted protein; n=1; Chaetomium glob... 34 5.3 UniRef50_A6RH13 Cluster: Predicted protein; n=2; Onygenales|Rep:... 34 5.3 UniRef50_A4RD40 Cluster: Putative uncharacterized protein; n=2; ... 34 5.3 UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe gri... 34 5.3 UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomyc... 34 5.3 UniRef50_A3GFK8 Cluster: Protein transport protein SEC31; n=2; P... 34 5.3 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 34 5.3 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 34 5.3 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 34 5.3 UniRef50_Q16630 Cluster: Cleavage and polyadenylation specificit... 34 5.3 UniRef50_Q9M3G8 Cluster: Putative proline-rich protein; n=2; Ara... 29 6.3 UniRef50_Q4Q3E5 Cluster: Putative uncharacterized protein; n=2; ... 28 6.9 UniRef50_UPI00015B605E Cluster: PREDICTED: similar to vasodilato... 33 7.0 UniRef50_UPI00015B56BE Cluster: PREDICTED: similar to Si:ch211-1... 33 7.0 UniRef50_UPI0000E463CE Cluster: PREDICTED: hypothetical protein;... 33 7.0 UniRef50_UPI0000DB6FB3 Cluster: PREDICTED: similar to plexus CG4... 33 7.0 UniRef50_UPI0000DA1F1A Cluster: PREDICTED: hypothetical protein;... 33 7.0 UniRef50_UPI0000584992 Cluster: PREDICTED: similar to actin bind... 33 7.0 UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; ... 33 7.0 UniRef50_UPI000023D566 Cluster: hypothetical protein FG01858.1; ... 33 7.0 UniRef50_UPI00006A19F8 Cluster: UPI00006A19F8 related cluster; n... 33 7.0 UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16;... 33 7.0 UniRef50_Q4TB69 Cluster: Chromosome 11 SCAF7190, whole genome sh... 33 7.0 UniRef50_Q4S280 Cluster: Chromosome undetermined SCAF14764, whol... 33 7.0 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 33 7.0 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 33 7.0 UniRef50_Q07701 Cluster: EBNA-2; n=1; Cercopithecine herpesvirus... 33 7.0 UniRef50_Q3UQ97 Cluster: 10 days lactation, adult female mammary... 33 7.0 UniRef50_Q398A8 Cluster: TonB-like protein; n=2; Burkholderia ce... 33 7.0 UniRef50_Q1CYB6 Cluster: Ferric siderophore transporter, peripla... 33 7.0 UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep... 33 7.0 UniRef50_A1TPB5 Cluster: TonB family protein; n=1; Acidovorax av... 33 7.0 UniRef50_Q9SNE9 Cluster: Putative uncharacterized protein F11C1_... 33 7.0 UniRef50_Q6H899 Cluster: Nuclear protein ZAP-like; n=6; Magnolio... 33 7.0 UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12;... 33 7.0 UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=... 33 7.0 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 33 7.0 UniRef50_Q7JR80 Cluster: SD23764p; n=1; Drosophila melanogaster|... 33 7.0 UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG214... 33 7.0 UniRef50_Q585V1 Cluster: Putative uncharacterized protein; n=1; ... 33 7.0 UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; ... 33 7.0 UniRef50_Q28Z67 Cluster: GA12281-PA; n=1; Drosophila pseudoobscu... 33 7.0 UniRef50_Q1ZXD2 Cluster: GRAM domain-containing protein; n=1; Di... 33 7.0 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 33 7.0 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 33 7.0 UniRef50_Q96S08 Cluster: Protein CTF18 homolog; n=22; cellular o... 33 7.0 UniRef50_Q6ZTJ3 Cluster: CDNA FLJ44595 fis, clone BLADE2004849; ... 33 7.0 UniRef50_Q7SEW0 Cluster: Predicted protein; n=1; Neurospora cras... 33 7.0 UniRef50_Q7S7P5 Cluster: Putative uncharacterized protein NCU037... 33 7.0 UniRef50_Q7S043 Cluster: Predicted protein; n=1; Neurospora cras... 33 7.0 UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cere... 33 7.0 UniRef50_Q560V3 Cluster: Putative uncharacterized protein; n=2; ... 33 7.0 UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein P... 33 7.0 UniRef50_O59907 Cluster: Annexin XIV; n=10; Pezizomycotina|Rep: ... 33 7.0 UniRef50_A6QWU5 Cluster: Predicted protein; n=10; Pezizomycotina... 33 7.0 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 33 7.0 UniRef50_P48023 Cluster: Tumor necrosis factor ligand superfamil... 33 7.0 UniRef50_O15047 Cluster: Histone-lysine N-methyltransferase, H3 ... 33 7.0 UniRef50_Q09564 Cluster: Protein phosphatase PHLPP-like protein;... 33 7.0 UniRef50_Q8N3X1 Cluster: Formin-binding protein 4; n=28; Eumetaz... 33 7.0 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 33 7.0 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 33 7.0 UniRef50_Q0AYX7 Cluster: Putative uncharacterized protein precur... 28 7.1 UniRef50_O00886 Cluster: RacGAP protein; n=2; Dictyostelium disc... 27 7.2 UniRef50_Q4QGH1 Cluster: Putative uncharacterized protein; n=3; ... 27 7.4 UniRef50_Q68BK1 Cluster: Poly(A) binding protein I; n=1; Nannoch... 27 7.5 UniRef50_Q0DIP2 Cluster: Os05g0373400 protein; n=7; Oryza sativa... 27 7.7 UniRef50_Q61345 Cluster: Forkhead box protein D1; n=5; Amniota|R... 28 7.8 UniRef50_Q6ENK4 Cluster: Putative uncharacterized protein P0645D... 28 8.3 UniRef50_Q54W13 Cluster: Putative uncharacterized protein; n=1; ... 31 9.1 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 33 9.3 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 33 9.3 UniRef50_UPI0000DD7E2C Cluster: PREDICTED: hypothetical protein;... 33 9.3 UniRef50_UPI0000DD7D57 Cluster: PREDICTED: hypothetical protein;... 33 9.3 UniRef50_UPI0000ECA614 Cluster: Proline-rich protein 11.; n=2; G... 33 9.3 UniRef50_UPI0000ECA1AD Cluster: UPI0000ECA1AD related cluster; n... 33 9.3 UniRef50_Q08BP2 Cluster: LOC562403 protein; n=5; Danio rerio|Rep... 33 9.3 UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FN... 33 9.3 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 33 9.3 UniRef50_Q825Z2 Cluster: Putative proline-rich protein; n=2; Str... 33 9.3 UniRef50_Q74G87 Cluster: OmpA domain protein; n=1; Geobacter sul... 33 9.3 UniRef50_Q47KZ3 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_Q2G984 Cluster: Putative uncharacterized protein precur... 33 9.3 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 33 9.3 UniRef50_A7IEJ5 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_A7BW26 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_A4T5N9 Cluster: Putative uncharacterized protein precur... 33 9.3 UniRef50_A3Q834 Cluster: Putative uncharacterized protein precur... 33 9.3 UniRef50_A3Q7Z4 Cluster: Putative uncharacterized protein; n=3; ... 33 9.3 UniRef50_A3Q1Z8 Cluster: Molecular chaperone-like; n=4; Mycobact... 33 9.3 UniRef50_Q9SD19 Cluster: Putative uncharacterized protein F24M12... 33 9.3 UniRef50_Q9LVN1 Cluster: Gb|AAD23008.1; n=2; Arabidopsis thalian... 33 9.3 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 33 9.3 UniRef50_Q8RVC4 Cluster: P0482D04.1 protein; n=4; Oryza sativa|R... 33 9.3 UniRef50_Q8LLB6 Cluster: Sukkula-1b polyprotein; n=3; Hordeum vu... 33 9.3 UniRef50_Q75GY0 Cluster: Expressed protein; n=2; Oryza sativa|Re... 33 9.3 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 33 9.3 UniRef50_Q0J702 Cluster: Os08g0244100 protein; n=1; Oryza sativa... 33 9.3 UniRef50_Q0J002 Cluster: Os09g0538700 protein; n=3; Oryza sativa... 33 9.3 UniRef50_Q0IS03 Cluster: Os11g0579700 protein; n=1; Oryza sativa... 33 9.3 UniRef50_A7R244 Cluster: Chromosome undetermined scaffold_398, w... 33 9.3 UniRef50_A3BQ84 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_A2Z3J4 Cluster: Putative uncharacterized protein; n=3; ... 33 9.3 UniRef50_Q9W363 Cluster: CG12124-PA; n=2; Drosophila melanogaste... 33 9.3 UniRef50_Q9TZM9 Cluster: Temporarily assigned gene name protein ... 33 9.3 UniRef50_Q7JW27 Cluster: RH66493p; n=2; Sophophora|Rep: RH66493p... 33 9.3 UniRef50_Q5CUV6 Cluster: Putative uncharacterized protein; n=2; ... 33 9.3 UniRef50_Q54HS3 Cluster: SET domain-containing protein; n=1; Dic... 33 9.3 UniRef50_Q54BJ4 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_Q4DHU0 Cluster: Lectin, putative; n=4; Trypanosoma cruz... 33 9.3 UniRef50_Q22CA6 Cluster: Annexin homolog protein; n=3; Tetrahyme... 33 9.3 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 33 9.3 UniRef50_O18195 Cluster: Putative uncharacterized protein ddl-2;... 33 9.3 UniRef50_A2ECL1 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_A0EAP8 Cluster: Chromosome undetermined scaffold_86, wh... 33 9.3 UniRef50_A0CFX0 Cluster: Chromosome undetermined scaffold_177, w... 33 9.3 UniRef50_Q752A6 Cluster: AFR669Wp; n=1; Eremothecium gossypii|Re... 33 9.3 UniRef50_Q0UPQ0 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated p... 33 9.3 UniRef50_Q15637 Cluster: Splicing factor 1; n=57; Euteleostomi|R... 33 9.3 UniRef50_Q4PB95 Cluster: Pre-mRNA-processing protein 45; n=1; Us... 33 9.3 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 33 9.3 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 33 9.3 UniRef50_O45886 Cluster: Putative uncharacterized protein; n=5; ... 27 9.9 UniRef50_Q38DG9 Cluster: Putative uncharacterized protein; n=1; ... 31 10.0 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 46.8 bits (106), Expect = 7e-04 Identities = 29/79 (36%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPP-XXXX 785 GG PP GG G P PGGF G PP GG GG PPPP Sbjct: 15 GGYPPPPPPDGGYPPPPPPDGGYPPAQPGGF---GPPPQGGYPPPPPPGGYPPPPQGGFP 71 Query: 786 KKKIXXXPPPPPXXXXAXP 842 PPPPP + P Sbjct: 72 PPPPGGYPPPPPPQGGSYP 90 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = -3 Query: 766 GGXPPXXIYFFXPPXGGXPXQKKPPGXF----XGXXPXPXXKXXXPPPXPXXGGXPP 608 GG PP F PP G PPG + G P P PPP P G PP Sbjct: 35 GGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPP 91 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/61 (36%), Positives = 24/61 (39%) Frame = -3 Query: 790 FXXXXXGGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXP 611 F GG PP + PP GG P PPG + P P PPP P G P Sbjct: 45 FGPPPQGGYPPPPPPGGYPPPPQGGFP--PPPPGGYP-PPPPPQGGSYPPPPPPGAAGYP 101 Query: 610 P 608 P Sbjct: 102 P 102 Score = 35.1 bits (77), Expect = 2.3 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKK------PPGXFXGXXPXPXXKXXXPPPXPXXGGXP 611 GG G PP Y PP GG P + PPG + P PPP G P Sbjct: 43 GGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPP 102 Query: 610 P 608 P Sbjct: 103 P 103 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPP--PXPXXGGXPP 608 GG PP F PP GG P P G P P PP P G PP Sbjct: 60 GGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPPGYPGGPGAGYPP 115 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 712 PXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 P PP G P P PPP P GG PP Sbjct: 5 PPGNNPPPPDGGYPPPPPPDGGYPPPPPPDGGYPP 39 >UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma japonicum|Rep: SJCHGC03138 protein - Schistosoma japonicum (Blood fluke) Length = 156 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F GA PPPP F KKK PPPPP PPP Sbjct: 30 FYGAPPPPPPFFFNKKKR----PPPPPGGPPPP 58 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +2 Query: 692 GXFFLXXXXXXXXXKKIYXXGRXPPPPPXXXXKKNXXXPPP--PPXPXXG 835 G FF ++ G PPPPP KK PPP PP P G Sbjct: 12 GGFFFFRGVFPPRGGPLFFYGAPPPPPPFFFNKKKRPPPPPGGPPPPFGG 61 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 41.1 bits (92), Expect = 0.035 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G G PPPP PPPPPPP PPP Sbjct: 689 GGGPPPPPPPPPMTGGGPPPPPPPPGGGPPP 719 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G G PPPP K PPPPPP PPP Sbjct: 714 GGGPPPPPPPPGAKAGGPPPPPPPFGKGPPP 744 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP PP GG P PPG G P P PP P G Sbjct: 703 GGGPPPPP----PPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPPGG 748 Score = 35.9 bits (79), Expect = 1.3 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GGGG PP P GG P PP G P PPP P GG PP Sbjct: 674 GGGGPPPPPPP--PPMTGGGPPPPPPPPPMTGGGP--------PPPPPPPGGGPP 718 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP----XXXPPP 843 G G PPPP PPPPPPP PPP Sbjct: 674 GGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPP 708 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P Sbjct: 676 GGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPP 709 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 690 GGPPPPPP-PPPMTGGGPPPPPPPPGGGPPPPPP 722 Score = 33.5 bits (73), Expect = 7.0 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = -3 Query: 817 GGGGXXXIFFXXXXXGGGGXPPXXIYFFXPPXGGXPXQKKPP--GXFXGXXPXPXXKXXX 644 GGGG GGG PP P GG P PP G P P K Sbjct: 674 GGGGPPPPPPPPPMTGGGPPPPPPP---PPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGG 730 Query: 643 PPPXPXXGGXPP 608 PPP P G P Sbjct: 731 PPPPPPPFGKGP 742 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP G P P Sbjct: 677 GPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPP 710 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G G PPPP PPPPPP PPP Sbjct: 659 GGGAPPPPPPPPPMTGGGGPPPPPP---PPP 686 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +3 Query: 663 GXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPPXXXXAXP 842 G P P G PP + GG PPPP PPPPP P Sbjct: 660 GGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPP 719 >UniRef50_Q17R98 Cluster: LOC152485 protein; n=42; Euteleostomi|Rep: LOC152485 protein - Homo sapiens (Human) Length = 1081 Score = 41.1 bits (92), Expect = 0.035 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP +K PPPPPPP PPP ++ Sbjct: 316 PPPPSEKKPEKVTPPPPPPPPPPPPPPPQS 345 >UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 205 Score = 40.7 bits (91), Expect = 0.046 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP PPP Sbjct: 138 PPPPPASSTKSAEAPPPPPPPPPPPPP 164 Score = 40.7 bits (91), Expect = 0.046 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP PPP Sbjct: 139 PPPPASSTKSAEAPPPPPPPPPPPPPP 165 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPP PPP Sbjct: 137 PPPPPPASSTKSAEAPPPPPPPPPPPP 163 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP K+ PPPPP P P Sbjct: 137 PPPPPPASSTKSAEAPPPPPPPPPPPP 163 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP K PPPPP P P Sbjct: 138 PPPPPASSTKSAEAPPPPPPPPPPPPP 164 >UniRef50_O97214 Cluster: Putative uncharacterized protein L4830.10; n=3; Leishmania|Rep: Putative uncharacterized protein L4830.10 - Leishmania major Length = 816 Score = 31.1 bits (67), Expect(2) = 0.049 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 650 PPPPPPPPPPPPP 662 Score = 28.7 bits (61), Expect(2) = 0.049 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPPP + PPPP PP Sbjct: 604 PPPPPGVTRSTTAPPPPPLPP 624 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 40.3 bits (90), Expect = 0.061 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GAG PPPP PPPPPPP PP Sbjct: 544 GAGIPPPPPVPGNAPPPPPPPPPPPGAGAPP 574 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P Sbjct: 555 GNAPPPPPPPPPPPGAGAPPPPPPPGPGLAPPPP 588 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPP P PPP K Sbjct: 561 PPPPPPPPGAGAPPPPPPPGPGLAPPPPK 589 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP G P PP G P P PPP P G PP Sbjct: 644 PPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP 693 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G P PP G P P PPP P G PP Sbjct: 643 PPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP 683 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXP 611 PP + PP G P PP G P P PPP P G P Sbjct: 654 PPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMP 702 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -3 Query: 730 PPXG--GXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G G P PPG G P P PPP P G PP Sbjct: 632 PPPGMPGMPPPPPPPG-MPGMPPPPPGMPGMPPPPPGMPGMPP 673 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 AG PPP K PPPPPPP PPP Sbjct: 540 AGGAPPPPPPPPPKGGAPPPPPPPARAPPP 569 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GAG PPPP PPPPPP PPP Sbjct: 529 GAGAPPPPPPPAGGAPPPPPPPPPKGGAPPP 559 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G PPPP K PPPPPP PPP T Sbjct: 542 GAPPPPPPPPPKGGAPPPPPPPARAPPPPAGT 573 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPP----PPPXXXPPPK 846 GAG PPPP PPPP PPP PPPK Sbjct: 518 GAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPK 553 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPP-GXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 G G PP PP G P PP G P P K PPP P PP Sbjct: 518 GAGVPPPP----PPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPP 568 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 G G PP PP GG P PP G P P PPP G PP Sbjct: 529 GAGAPPPP----PPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPP---PAGTPP 575 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 531 GAPPPPPPPAG---GAPPPPPPPPPKGGAPPPPP 561 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP K PPPPPPP PPP Sbjct: 363 APPPPPPPPPPPPKGAPPPPPPPPPPPPPP 392 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 370 PPPPPPKGAPPPPPPPPPPPPPPGPPP 396 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 371 PPPPPKGAPPPPPPPPPPPPPPGPPPP 397 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P P Sbjct: 366 PPPPPPPPPPKGAPPPPPPPPPPPPPPGPPP 396 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPP K PPPPPPP PPPK Sbjct: 353 PPPQQQQNKSAPPPPPPPPP---PPPK 376 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 365 PPPPPPPPPPPKGAPPPPPPPPPPPPPPGPP 395 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P + P Sbjct: 371 PPPPPKGAPPPPPPPPPPPPPPGPPPPGQLP 401 >UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein family, member 3; n=1; Gallus gallus|Rep: WAS/WASL interacting protein family, member 3 - Gallus gallus Length = 407 Score = 33.9 bits (74), Expect(2) = 0.087 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K + PPPPP P Sbjct: 177 PPPPPPAASKPSLTFPPPPPLP 198 Score = 25.0 bits (52), Expect(2) = 0.087 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 806 PPPPPXPXXGXPXK 847 PPPPP P G P + Sbjct: 237 PPPPPLPPCGFPAR 250 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 39.5 bits (88), Expect = 0.11 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 67 PPPPVTYNYPAPPPPPPPPPPPPPPPP 93 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 65 PPPPPPVTYNYPAPPPPPPPPPPPPPP 91 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 66 PPPPPVTYNYPAPPPPPPPPPPPPPPP 92 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 64 PPPPPPPVTYNYPAPPPPPPPPPPPPP 90 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 487 PPPPPP--PPPPPRPPPPPPPPSQPPP 511 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP N PPPPP P Sbjct: 543 PPPPPSLPVTYNYPSPPPPPPP 564 >UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear polyhedrosis virus|Rep: ORF1629 - Leucania separata nuclear polyhedrosis virus (LsNPV) Length = 589 Score = 39.5 bits (88), Expect = 0.11 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 254 PPPPPPMPVESGSPPPPPPPPPPPPPP 280 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 256 PPPPMPVESGSPPPPPPPPPPPPPPPP 282 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 255 PPPPPMPVESGSPPPPPPPPPPPPPPP 281 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 253 PPPPPPPMPVESGSPPPPPPPPPPPPP 279 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 252 PPPPPPPPMPVESGSPPPPPPPPPPPP 278 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 252 PPPPPPPPMPVESGSPPPPPPPPPPPPPPPP 282 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 I G PPPP PPPPPPP PPP Sbjct: 738 ITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPP 771 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 740 GGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPP 773 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 766 GGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GG PP PP G P PPG P PPP P GG PP Sbjct: 724 GGPPPPPPPGGLPPITGGPPPPPPPGGL------PPISGGPPPPPPPPGGCPP 770 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G PPPP PPPPPPP PP Sbjct: 724 GGPPPPPPPGGLPPITGGPPPPPPPGGLPP 753 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P P P Sbjct: 741 GPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPP 774 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G PPPP PPPPPPP PP Sbjct: 711 GGPPPPPGLPPITGG-PPPPPPPGGLPP 737 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GG PP P GG P PPG G P P PPP GG PP Sbjct: 740 GGPPPPPPPGGLPPISGGPPPPPPPPG---GCPPPP----PPPPPGGFKGGPPP 786 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 39.5 bits (88), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP PPP Sbjct: 271 PPPPAPSAKGGAPPPPPPPPPPPPPPP 297 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 GA PPPP PPPPPPP PPP + Sbjct: 281 GAPPPPPP-----PPPPPPPPPPPPKGVPPPPR 308 >UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|Rep: Adhesin FhaB - Bordetella avium Length = 2621 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K K PPPPPPP PPPK Sbjct: 2374 PPPPPPPPKVKKVDPPPPPPP--PPPPK 2399 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K K PPPPPPP PPPK Sbjct: 2423 PPPPPPPPKVKKVDPPPPPPP--PPPPK 2448 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K K PPPPPPP PPPK Sbjct: 2342 PPPPPPPPKVKKVDPPPPPPP---PPPK 2366 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K K PPPPPPP PPPK Sbjct: 2358 PPPPPPPPKVKKVDPPPPPPP---PPPK 2382 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K K PPPPPPP PPPK Sbjct: 2407 PPPPPPPPKVKKVDPPPPPPP---PPPK 2431 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K K PPPPPPP PPPK Sbjct: 2456 PPPPPPPPKVKKVDPPPPPPP---PPPK 2480 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP-----XXXPPPK 846 PPPP K K PPPPPPP PPPK Sbjct: 2472 PPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPPK 2504 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP----XXXPPP 843 PPPP K K PPPPPPP PPP Sbjct: 2328 PPPPPPPPKVKKVDPPPPPPPPKVKKVDPPP 2358 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 2343 PPPPPPPKVKKVDPPPPPPPPP 2364 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 2359 PPPPPPPKVKKVDPPPPPPPPP 2380 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 2375 PPPPPPPKVKKVDPPPPPPPPP 2396 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 Query: 734 KKIYXXGRXPPPPPXXXXKKNXXXPPPPPXP 826 KK+ PPPPP K + PPPPP P Sbjct: 2384 KKVDPPPPPPPPPPPKVKKVDPPPPPPPPPP 2414 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 2408 PPPPPPPKVKKVDPPPPPPPPP 2429 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 2424 PPPPPPPKVKKVDPPPPPPPPP 2445 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 Query: 734 KKIYXXGRXPPPPPXXXXKKNXXXPPPPPXP 826 KK+ PPPPP K + PPPPP P Sbjct: 2433 KKVDPPPPPPPPPPPKVKKVDPPPPPPPPPP 2463 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 2457 PPPPPPPKVKKVDPPPPPPPPP 2478 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 2473 PPPPPPPKVKKVDPPPPPPPPP 2494 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKK 850 PPPPP K PPPPP P KK Sbjct: 2373 PPPPPPPPPKVKKVDPPPPPPPPPPPKVKK 2402 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKK 850 PPPPP K PPPPP P KK Sbjct: 2422 PPPPPPPPPKVKKVDPPPPPPPPPPPKVKK 2451 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K + PPPPP P Sbjct: 2344 PPPPPPKVKKVDPPPPPPPPPP 2365 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K + PPPPP P Sbjct: 2360 PPPPPPKVKKVDPPPPPPPPPP 2381 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K PPPPPP PPPK Sbjct: 2390 PPPPPPPPPKVKKVDPPPPPP--PPPPK 2415 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K + PPPPP P Sbjct: 2409 PPPPPPKVKKVDPPPPPPPPPP 2430 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K PPPPPP PPPK Sbjct: 2439 PPPPPPPPPKVKKVDPPPPPP--PPPPK 2464 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K + PPPPP P Sbjct: 2458 PPPPPPKVKKVDPPPPPPPPPP 2479 Score = 33.1 bits (72), Expect = 9.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPPK Sbjct: 2323 PPPPPPPPPPPPPK 2336 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2327 PPPPPPPPPKVKKVDPPPPPPP 2348 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2328 PPPPPPPPKVKKVDPPPPPPPP 2349 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2342 PPPPPPPPKVKKVDPPPPPPPP 2363 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2357 PPPPPPPPPKVKKVDPPPPPPP 2378 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2358 PPPPPPPPKVKKVDPPPPPPPP 2379 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 Query: 717 PPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPP 821 PP K + PPPP KK+ PPPPP Sbjct: 2377 PPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP 2411 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2406 PPPPPPPPPKVKKVDPPPPPPP 2427 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2407 PPPPPPPPKVKKVDPPPPPPPP 2428 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 Query: 717 PPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPP 821 PP K + PPPP KK+ PPPPP Sbjct: 2426 PPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP 2460 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2455 PPPPPPPPPKVKKVDPPPPPPP 2476 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2456 PPPPPPPPKVKKVDPPPPPPPP 2477 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2471 PPPPPPPPPKVKKVDPPPPPPP 2492 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 2472 PPPPPPPPKVKKVDPPPPPPPP 2493 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 39.1 bits (87), Expect = 0.14 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1436 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PPPP PPPPPPP PPP T Sbjct: 1408 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPT 1440 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 1427 PPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 1428 PPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 39.1 bits (87), Expect = 0.14 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 681 PPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP PPPPPPP PPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPP 259 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 672 PPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 676 PPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPP 258 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 685 PPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPP PP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPP 239 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPP 250 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP PPPPPPP PPP Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710 >UniRef50_A4RW22 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 643 Score = 39.1 bits (87), Expect = 0.14 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 48 PPPPPKATAARRAPPPPPPPPKRQPPP 74 Score = 37.1 bits (82), Expect = 0.57 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP ++ PPPPPP PPP Sbjct: 49 PPPPKATAARRAPPPPPPPPKRQPPPP 75 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 47 PPPPPPKATAARRAPPPPPPPPKRQPP 73 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 47 PPPPPPKATAARRAPPPPPPPPKRQPPPPPP 77 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 39.1 bits (87), Expect = 0.14 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPPP PPP K Sbjct: 642 PPPPPPPPLPNTQVPPPPPPPPPPPPPSK 670 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP K PPPPP G P P Sbjct: 686 GAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPP 719 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP--XXGXPXKKP 853 PPPPP KN PPPPP P G P P Sbjct: 660 PPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPP 692 Score = 35.1 bits (77), Expect = 2.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP +N PPPPP P Sbjct: 674 PPPPPPPPPSRNGAPPPPPPPP 695 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXP--XXGXPXKKP 853 G PPPPP + PPPPP P G P P Sbjct: 672 GAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPP 707 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 PPPPP PPPPP P P K Sbjct: 642 PPPPPPPPLPNTQVPPPPPPPPPPPPPSK 670 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 39.1 bits (87), Expect = 0.14 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP PPP Sbjct: 70 PPPPQIEPDKFEEAPPPPPPPPPPPPP 96 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPP PPP Sbjct: 69 PPPPPQIEPDKFEEAPPPPPPPPPPPP 95 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP K + PPPPPPP PPP Sbjct: 71 PPPQIEPDKFEEAPPPPPPPPPPPPPP 97 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPPPPP PPP Sbjct: 46 PPPTVEEQPPPPPPPPPPPPPPPPPP 71 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P P Sbjct: 69 PPPPPQIEPDKFEEAPPPPPPPPPPPPPPPP 99 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 46 PPPTVEEQPPPPPPPPPPPPPPPPPPP 72 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 607 GAPPPPPPPPPPGGGPPPPPPPPGSGPPP 635 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 596 PPPPPPPSGSGGAPPPPPPPPPPGGGPPPPP 626 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 597 PPPPPPSGSGGAPPPPPPPPPPGGGPPPPPP 627 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G+G PPP PPPPPPP PP Sbjct: 604 GSGGAPPPPPPPPPPGGGPPPPPPPPGSGPP 634 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPP PPP Sbjct: 606 GGAPPPPPPPPPPGGGPPPPPPPPGSGPPPP 636 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 595 PPPPPPPPSGSGGAPPPPPPPPPPGGGPPPP 625 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 AG PPP PPPPPPP PPP Sbjct: 553 AGLAPPPPPLPGAMMPPPPPPPPPPGGPPP 582 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F G PPPP PPPPPPP PPP Sbjct: 552 FAGLAPPPPPLP-GAMMPPPPPPPPPPGGPPPP 583 >UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region; n=1; Caulobacter sp. K31|Rep: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region - Caulobacter sp. K31 Length = 608 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPPPPP PPP +T Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPVET 501 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 466 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 737 KIYXXGRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 + Y PPPPP PPPPP P P P Sbjct: 460 RTYAHDASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 736 KNIFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +NI PPPP PPPPPPP PPP Sbjct: 197 QNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPP 232 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPP 233 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPP 236 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPP 234 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 232 PPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 241 PPPPPPPPPPPSPPPPPPPPSPSPPPPPPSP 271 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 235 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPP 237 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPP 238 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXP-PPPPPPXXXPPP 843 PPPP P PPPPPP PPP Sbjct: 257 PPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 236 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 232 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP K PPPPP P KKP Sbjct: 1044 GAPPPPPPPPPPMKGGAGPPPPPPPPGKLGAKKP 1077 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P K P Sbjct: 1048 PPPPPPPPMKGGAGPPPPPPPPGKLGAKKPP 1078 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 560 GGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPP 593 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 G G PPPP PPPPPPP PPP Sbjct: 559 GGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPP 591 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP G P P Sbjct: 561 GPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPP 594 >UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: KIAA1856 protein - Homo sapiens (Human) Length = 1134 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 GAG PPP + PPPPPPP PP Sbjct: 937 GAGLPPPRAPALPSEARAPPPPPPPPPHPP 966 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPPP PPP++ Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPPP PPP + Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 >UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor; n=2; Rattus norvegicus|Rep: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor - Rattus norvegicus Length = 542 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPPP PPP K Sbjct: 411 PPPPVPPPTPPPPPPPPPPPPPPPPPPVK 439 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPP PPPPPPP PPP Sbjct: 317 GHPPPRPVPPPAPPPPPPPPPPPPRPPPP 345 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 624 GAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPP 657 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 640 PPPPPPPLPGAGPPPPPPPPLPGAGPPPPPP 670 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPP-PXXXPPP 843 AG PPPP PPPPPP P PPP Sbjct: 637 AGLPPPPPPPLPGAGPPPPPPPPLPGAGPPP 667 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GAG PPPP PPPPPP PP Sbjct: 649 GAGPPPPPPPPLPGAGPPPPPPPPLSGAGPP 679 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP G P P Sbjct: 653 PPPPPPPLPGAGPPPPPPPPLSGAGPPPPPP 683 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 1078 AAPPPPPPPAPVTGPTPPPPPPPPPPPPPP 1107 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 F A PPPP PPPPPPP PP T Sbjct: 1076 FIAAPPPPPPPAPVTGPTPPPPPPPPPPPPPPAPVT 1111 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G PPP PPPPPPP PP ++ Sbjct: 938 GLEESPPPAPTPSPPPPPPPPPPPPPPPPPQQQ 970 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G+ PP PPPPPPP PPP Sbjct: 745 GSNHIPPQQQQTSPPPPPPPPPPPPPPPPPP 775 >UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus 15|Rep: EBNA-2 - Cercopithecine herpesvirus 15 (Rhesus lymphocryptovirus) Length = 605 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPPP PPP++ Sbjct: 69 PPPPPLPPPPPPPLPPPPPPPVQPPPPER 97 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXP-PPPPPPXXXPPP 843 GA PPPP P PPPPPP PPP Sbjct: 63 GAPPPPPPPPPLPPPPPPPLPPPPPPPVQPPP 94 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 304 ASPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F PPPP PPPPPPP PPP Sbjct: 303 FASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPP 336 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 229 GFAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 AG PPP PPPPPPP PPP Sbjct: 228 AGFAPPPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 231 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP PPPPPPP PP+ Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPFQPPR 266 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P + P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPFQPP 265 >UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Rickettsia bellii|Rep: Cell surface antigen Sca2-6 - Rickettsia bellii Length = 909 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 42 AAPPPPPPPPPPPPPPPPPPPPPPTPPPPP 71 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PPPP PPPPPP PP KT Sbjct: 43 APPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKT 75 >UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2; Hyphomonadaceae|Rep: OmpA/MotB domain protein precursor - Maricaulis maris (strain MCS10) Length = 359 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 214 AAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F PPPP PPPPPPP PPP Sbjct: 213 FAAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 >UniRef50_Q01HW3 Cluster: B0616E02-H0507E05.9 protein; n=4; Oryza sativa|Rep: B0616E02-H0507E05.9 protein - Oryza sativa (Rice) Length = 615 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + K PPPPPPP PP Sbjct: 352 PPPPPQQQRAKPSRPPPPPPPLDPPP 377 Score = 36.7 bits (81), Expect = 0.75 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP ++ PPPPPP PPP+ Sbjct: 351 PPPPPPQQQRAKPSRPPPPPPPLDPPPR 378 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSP 253 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPP 251 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPP 251 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPP 255 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPP 264 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPP 258 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP PPPPPPP PPP Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 273 PPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 274 PPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 >UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis thaliana|Rep: P140mDia like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 645 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 G PPPP PPPPP P PPPK Sbjct: 306 GRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPK 337 >UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr16 scaffold_94, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 341 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPPP PPP K Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPVK 76 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 44 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 >UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Protease - Cryptosporidium hominis Length = 1569 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 1538 PPPPPPPPSSSSPSPPPPPPPLPPPPP 1564 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPP PP PPP K Sbjct: 1541 PPPPPSSSSPSPPPPPPPLPPPPPPPPPK 1569 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 1537 PPPPPPPPPSSSSPSPPPPPPPLPPPPPPPP 1567 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 1536 PPPPPPPPPPSSSSPSPPPPPPPLPPP 1562 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G+G PP PPPPPPP PP Sbjct: 1516 GSGSNSPPLPPPSSSSPSPPPPPPPPPPPP 1545 >UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 472 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 327 PPPPPPPPQSANAPPPPPPPPVSAPPP 353 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P P Sbjct: 327 PPPPPPPPQSANAPPPPPPPPVSAPPPFNPP 357 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 R PPPPP KN PPPPP P K P Sbjct: 469 RTPPPPPPPPPGKNAPPPPPPPPPPPPHGKKAP 501 >UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 994 Score = 38.3 bits (85), Expect = 0.25 Identities = 26/70 (37%), Positives = 27/70 (38%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPPXXXXK 788 G PP G GGG G G P G W G PP G + GG PPPP Sbjct: 521 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGW-GQPPPGAGQ-----GGGPPPPGAGQ- 573 Query: 789 KKIXXXPPPP 818 PPPP Sbjct: 574 ---GGGPPPP 580 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/58 (36%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = -3 Query: 769 GGGXPPXXI---YFFXPPXGGXPXQKKPPGXFXGXXPXP-XXKXXXPPPXPXXGGXPP 608 GGG PP + PP G + PPG G P P + PPP GG PP Sbjct: 574 GGGPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPP 631 Score = 33.1 bits (72), Expect = 9.3 Identities = 26/75 (34%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPXG-----GXKKYIXXGGXPPPP 773 G PP G GGG G G P G W G PP G G G PPPP Sbjct: 554 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGW-GQPPPGAGQGWGQPPPGAGQGGPPPP 612 Query: 774 XXXXKKKIXXXPPPP 818 + PPPP Sbjct: 613 GAGQE-----GPPPP 622 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 38.3 bits (85), Expect = 0.25 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + ++ PPPPPPP PP Sbjct: 308 PPPPPPYPEQVPPPPPPPPPPPPPPP 333 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP + PPPPP P PPP Sbjct: 295 GPPPPP--YPAPTPYPPPPPPYPEQVPPP 321 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP P P Sbjct: 309 PPPPPYPEQVPPPPPPPPPPPPPPPYP 335 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP K PPPPPPP PP Sbjct: 656 GGPPPPPPPPGSKAGGPPPPPPPGAPQPP 684 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K+ PPPPP P P P Sbjct: 604 PPPPPPPPPVKSAPLPPPPPPPKIAAPPPPP 634 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP P +PPG P P K PPP P G P Sbjct: 634 PPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQP 683 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 G PPPP + PPPPPPP PPP Sbjct: 641 GPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPP 674 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP K PPPPPPP PP Sbjct: 628 AAPPPPPPP--PMKAGPPPPPPPPGVPRPP 655 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 128 PPPPPPAPTTSKAAPPPPPPPPPPPPP 154 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP P P Sbjct: 130 PPPPAPTTSKAAPPPPPPPPPPPPPAP 156 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +1 Query: 754 AGXPP--PPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PP PP + PPPPPPP PPP T Sbjct: 82 APPPPQSPPAPTTTAQAPPPPPPPPPPPPPPPAPT 116 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP + PPPPPPP PPP T Sbjct: 110 PPPPAPTTTQAPQYPPPPPPP---PPPAPT 136 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 127 PPPPPPPAPTTSKAAPPPPPPPPPPPPPAPP 157 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P + PPPPPPP P P T Sbjct: 89 PPAPTTTAQAPPPPPPPPPPPPPPPAPTTT 118 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP--XPXXGXPXKKP 853 PPPPP K PPPPP P P KP Sbjct: 129 PPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKP 161 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F + PPPP PPPPPPP PPP Sbjct: 52 FMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSLLPP 93 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPP 843 P F PPPPPPP PPP Sbjct: 49 PQTFMASPPPPPPPPPPPPPPPPP 72 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSLLPP 93 >UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family member 4; n=37; Euteleostomi|Rep: Wiskott-Aldrich syndrome protein family member 4 - Homo sapiens (Human) Length = 625 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 507 PPPPLSQPTRGAPPPPPPPPPGPPPPP 533 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPP + PPPPPPP PPP T Sbjct: 507 PPPPLSQPTRGAPPPPPPPPPGPPPPPFT 535 >UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n=2; Nucleopolyhedrovirus|Rep: Essential structural protein pp78-81 - Lymantria dispar multicapsid nuclear polyhedrosis virus (LdMNPV) Length = 555 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP +K PPPPPPP PPP Sbjct: 254 PPPPEPLQQKSSAVPPPPPPP--LPPP 278 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP ++K PPPPPP PP Sbjct: 253 PPPPPEPLQQKSSAVPPPPPPPLPPP 278 Score = 34.7 bits (76), Expect = 3.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP +K+ PPPPP P Sbjct: 253 PPPPPEPLQQKSSAVPPPPPPP 274 >UniRef50_Q1MDU0 Cluster: Putative proline rich protein; n=1; Rhizobium leguminosarum bv. viciae 3841|Rep: Putative proline rich protein - Rhizobium leguminosarum bv. viciae (strain 3841) Length = 352 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P + K PPPPPPP PP KT Sbjct: 78 PPEPKPPEEAKKEPPPPPPPPPPPPPASKT 107 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 506 PPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 507 PPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 508 PPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPP 515 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPP 516 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPP 527 >UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like protein precursor; n=5; Mycobacterium|Rep: U5 snRNP spliceosome subunit-like protein precursor - Mycobacterium sp. (strain JLS) Length = 137 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 90 PPPPPGAPPPPPPPPPPPPPPVYVPPP 116 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 83 PPPPPPPPPPPPGAPPPPPPPPPPPPP 109 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 84 PPPPPPPPPPPGAPPPPPPPPPPPPPP 110 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 89 PPPPPPGAPPPPPPPPPPPPPPVYVPP 115 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 91 PPPPGAPPPPPPPPPPPPPPVYVPPPP 117 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP K PPPPPPP PP Sbjct: 549 PPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP KK PPPPPP PP Sbjct: 750 PPPPPLMTGKKAPAPPPPPPQAPKPP 775 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPP PPP Sbjct: 548 PPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K PPPPPPP P P+ Sbjct: 550 PPPPPSGNKPAFSPPPPPPPPPPPPLPQ 577 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP----XXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 606 PPPPPILPNRSVPPPPPPPPPLPNHSVLPPP 636 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 PPPPP + PPPPP P P + Sbjct: 620 PPPPPPPLPNHSVLPPPPPPPPPPSLPNR 648 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP N PPPPP P Sbjct: 603 PPPPPPPPILPNRSVPPPPPPP 624 Score = 33.1 bits (72), Expect = 9.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP ++ PPPPP P Sbjct: 605 PPPPPPILPNRSVPPPPPPPPP 626 >UniRef50_Q8LJ87 Cluster: Putative leucine-rich repeat/extensin 1; n=4; Oryza sativa|Rep: Putative leucine-rich repeat/extensin 1 - Oryza sativa subsp. japonica (Rice) Length = 503 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 450 PPPPKTSPPPPVSSPPPPPPPTMSPPP 476 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 64 PPPPPLKPSSGAPCPPPPPPPPPPPPP 90 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K P PPPPP PPP Sbjct: 62 PPPPPPPLKPSSGAPCPPPPPPPPPPP 88 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 63 PPPPPPLKPSSGAPCPPPPPPPPPPPP 89 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + P PPPPP PPP Sbjct: 157 PPPPPPPITRSGAPPSPPPPPSPPPPP 183 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G PPPP + PPPPPP PPP + Sbjct: 253 GGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPR 285 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 GR PPPPP + PPPPP P + P Sbjct: 254 GRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGP 287 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F PPPP PPPPP P PPP Sbjct: 153 FNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPP 185 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 63 PPPPPPLKPSSGAPCPPPPPPPPPPPPPSAP 93 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP G P P Sbjct: 180 PPPPPPPGARPGPPPPPPPPGARPGPPPPPP 210 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP P P Sbjct: 179 PPPPPPPPGARPGPPPPPPPPGARPGP 205 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 160 PPPPITRSGAPPSPPPPPSPPPPPPPP 186 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G P PPP PPPPP P G P P Sbjct: 187 GARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPP 220 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP K+ PPPPPPP PPP Sbjct: 654 PPPTGGPKQPPPPPPPPPPPPPPPPP 679 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G PPP + PPPPPPP PPP + Sbjct: 652 GLPPPTGGPKQPPPPPPPPPPPPPPPPPPPR 682 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Frame = +1 Query: 754 AGXPPP-----PXXFXKKKXXXPPPPPPPXXXPPP 843 AG PPP P K PPPPPPP PPP Sbjct: 643 AGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPP 677 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 763 GXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 G PP PP GG P Q PP P P PPP P G PP Sbjct: 644 GLPPPHPPGLPPPTGG-PKQPPPP------PPPPPPPPPPPPPPPRMGNGPP 688 >UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: Formin A - Trypanosoma cruzi strain CL Brener Length = 1178 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP K PPPPPPP PP Sbjct: 653 PPPPPGAGAKSGLSPPPPPPPPPPPP 678 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP K PPPPPP PPP Sbjct: 648 GLPPPPPPPPGAGAKSGLSPPPPPPPPPPPP 678 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP K+ PPPPP P G Sbjct: 524 PPPPPPGAGAKSGLPPPPPPPPGAG 548 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP K+ PPPPP P G Sbjct: 540 PPPPPPGAGAKSGLPPPPPPPPGAG 564 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP K+ PPPPP P G Sbjct: 556 PPPPPPGAGAKSGLPPPPPPPPGAG 580 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP K+ PPPPP P G Sbjct: 572 PPPPPPGAGAKSGLPPPPPPPPGAG 596 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP K+ PPPPP P G Sbjct: 588 PPPPPPGAGAKSGLPPPPPPPPGAG 612 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP K+ PPPPP P G Sbjct: 604 PPPPPPGAGAKSGLPPPPPPPPGAG 628 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP K+ PPPPP P G Sbjct: 620 PPPPPPGAGAKSGLPPPPPPPPGAG 644 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP K+ PPPPP P G Sbjct: 636 PPPPPPGAGAKSGLPPPPPPPPGAG 660 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K PPPPPPP P +T Sbjct: 675 PPPPGAGAKSGLPPPPPPPPPKAKSRPAQT 704 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K+ PPPPP P Sbjct: 673 PPPPPPGAGAKSGLPPPPPPPP 694 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 674 PPPPPGAGAKSGLPPPPPPPPP 695 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP K PPPPPPP Sbjct: 536 GLPPPPPPPPGAGAKSGLPPPPPPP 560 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP K PPPPPPP Sbjct: 552 GLPPPPPPPPGAGAKSGLPPPPPPP 576 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP K PPPPPPP Sbjct: 568 GLPPPPPPPPGAGAKSGLPPPPPPP 592 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP K PPPPPPP Sbjct: 584 GLPPPPPPPPGAGAKSGLPPPPPPP 608 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP K PPPPPPP Sbjct: 600 GLPPPPPPPPGAGAKSGLPPPPPPP 624 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP K PPPPPPP Sbjct: 616 GLPPPPPPPPGAGAKSGLPPPPPPP 640 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP K PPPPPPP Sbjct: 632 GLPPPPPPPPGAGAKSGLPPPPPPP 656 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G G PPPP PPPPPPP PP Sbjct: 452 GGGPPPPPPPPPGPGGGPPPPPPPPGGGPP 481 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP GG P PP G P P PPP P GG PP Sbjct: 421 PPPGGVPPPPPPPPPGMGGAPPP-----PPPPPPGMGGGPP 456 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 444 PPPPPPGMGGGPPPPPPPPPGPGGGPPPPPP 474 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P Sbjct: 439 GAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPP 472 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 736 KNIFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 K +F +G PPPP PPPPP PPP Sbjct: 408 KFLFYFSGPPPPPPPPGGVPPPPPPPPPGMGGAPPP 443 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P Sbjct: 425 GVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPP 458 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 454 GPPPPPPPPPG--PGGGPPPPPPPPGGGPPGPPP 485 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPP 71 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 1951 PPPPPPPPPTEDPPPPPPPPPAEAPPP 1977 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPP 68 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPP 69 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP PPPPPPP PPP+ Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPPE 74 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PPPP + PPPPPP PPP T Sbjct: 1949 APPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPT 1981 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPP---PXXXPPPKKT 852 A PPPP PPPPPP P PPP +T Sbjct: 51 ASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPET 86 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P +P Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEP 75 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 >UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding; n=1; Yarrowia lipolytica|Rep: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding - Yarrowia lipolytica (Candida lipolytica) Length = 1851 Score = 37.9 bits (84), Expect = 0.33 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = +3 Query: 618 PPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPP--XGGXKKYIXXGGXPPPPXXXXKK 791 PP GG F G P P GF PP GG GG PPPP Sbjct: 1051 PPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPPPLP 1110 Query: 792 KIXXXPPPPP 821 PPPP Sbjct: 1111 PGFTGGPPPP 1120 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 663 PXKKXXXPPPXPXXGXPPPXXGGXLNFFSXGGERKKXFFXPXGWXGGPP 517 P K PPP P PP GG F+ GG P G+ GGPP Sbjct: 1036 PVKFTGGPPPPPPPPPPPMFTGGPPPMFT-GGPPPPPPPPPPGFTGGPP 1083 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P P Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 G G PPPP + PPPPPPP PPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P Sbjct: 522 GAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPP 555 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP + PPPPPPP Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GGG PP GG P PP P P PPP P GG PP Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP------PPPPPGMGGPPP 568 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPPP P Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 >UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 9.t00033 - Entamoeba histolytica HM-1:IMSS Length = 540 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G G PPPP PPPPPP PPP Sbjct: 409 GCGIPPPPPPARGTGCGAPPPPPPLNAPPPP 439 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 654 FXXGXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPPXXXX 833 F G G P P G PP + G PPPP PPPPP Sbjct: 377 FDTGCGVPPPPPPARGTGCGAPPPPPPPAFDTGCGIPPPPPPARGTGCGAPPPPPPLNAP 436 Query: 834 AXP 842 P Sbjct: 437 PPP 439 >UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG01070.1 - Gibberella zeae PH-1 Length = 217 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP + PPPPPPP P PK Sbjct: 63 PPPPPPVIEVPCSPPPPPPPPVEKPKPK 90 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + + PPPPPP PPP Sbjct: 42 PPPPVIY---RPPLPPPPPPQFYPPPP 65 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 178 PPPPFPLFPLFPPPPPPPPPPPFSPPP 204 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP F PPPPPPP PPP Sbjct: 179 PPPFPLFPLFPPPPPPPPPPPFSPPPP 205 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 387 GAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGP 420 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 406 PPPPPPPPGLPGAGPPPPPPPPGCGPPPPPP 436 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPP--PXXXPPP 843 F G PPPP PPPPPP P PPP Sbjct: 371 FLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPP 405 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P Sbjct: 373 GPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPP 406 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P Sbjct: 357 GAPPPPPPPPPPPGFLGPPPPPPPPLPGNTGAPP 390 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PP Sbjct: 402 GPPPPPPPPPPPGLPGAGPPPPPPPPGCGPP 432 >UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rhodococcus sp. RHA1|Rep: Possible proline rich protein - Rhodococcus sp. (strain RHA1) Length = 338 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPP--PPPXXXPPP 843 G PPPP + + PPPP PPP PPP Sbjct: 82 GGNYPPPPGNYPPPQGNYPPPPQGPPPGGYPPP 114 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GG PP + PP GG PPG + P P PP P GG PP Sbjct: 66 GGNYPPPSGGNYPPPSGGN--YPPPPGNY----PPPQGNYPPPPQGPPPGGYPP 113 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 721 GGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GG P Q PP G P P PP P GG PP Sbjct: 18 GGYPPQGNPPPP-PGGYPPPPGNYPPPPQGPPPGGYPP 54 >UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas neptunium ATCC 15444|Rep: OmpA family protein - Hyphomonas neptunium (strain ATCC 15444) Length = 387 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 F PPPP PPPPPPP PPP++T Sbjct: 228 FAAPPAPPPPPP-PPPPPPPPPPPPPPPPPPPPEET 262 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPEETTPP 265 >UniRef50_A4TTL3 Cluster: Putative uncharacterized protein; n=2; cellular organisms|Rep: Putative uncharacterized protein - Magnetospirillum gryphiswaldense Length = 374 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +3 Query: 699 FFWXGXPPXGGXKKYIXX---GGXPPPPXXXXKKKIXXXPPPPP 821 FF+ P GG + GG PPPP KK PPPPP Sbjct: 62 FFFPPPPRRGGGGVFFYKKKRGGPPPPPTTQKKKNFFFSPPPPP 105 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP KKN PPPP G Sbjct: 85 PPPPPTTQKKKNFFFSPPPPPSFWG 109 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 G+ PPPP F PPPPPPP PPP Sbjct: 993 GSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPP 1025 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 943 PPPPPPPPPSYGSPPPPPPPPPSYGSPPPPP 973 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 956 PPPPPPPPPSYGSPPPPPPPPPGYGSPPPPP 986 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 969 PPPPPPPPPGYGSPPPPPPPPPSYGSPPPPP 999 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G+ PPPP PPPPPP PPP Sbjct: 941 GSPPPPPPPPPSYGSPPPPPPPPPSYGSPPP 971 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G+ PPPP PPPPPP PPP Sbjct: 967 GSPPPPPPPPPGYGSPPPPPPPPPSYGSPPP 997 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G+ PPPP PPPPPP PPP Sbjct: 954 GSPPPPPPPPPSYGSPPPPPPPPPGYGSPPP 984 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXX----PPPXPXXGGXPP 608 GG PP PP G PP F G P P PPP P GG PP Sbjct: 1046 GGAPPPPP----PPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPP 1099 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXX----PPPXPXXGGXPP 608 GG PP P GG P PP G P P PPP P GG PP Sbjct: 1033 GGAPPPPPP---PPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPP 1087 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 +F GA PPPP + PPPPPPP PPP Sbjct: 1069 MFGGAQPPPPP----PMRGGAPPPPPPPMRGGAPPP 1100 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP----XXXPPP 843 G G PPPP PPPPPPP PPP Sbjct: 978 GYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPP 1012 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP G P P Sbjct: 1020 GGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPP 1053 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP G P P Sbjct: 1033 GGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPP 1066 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP G P P Sbjct: 997 PPPPPPFSHVSSIPPPPPPPPMHGGAPPPPP 1027 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP----PXXXPPP 843 G PPPP + PPPPPP P PPP Sbjct: 1131 GGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPP 1165 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPP P P G P P Sbjct: 1148 PPPPPPPGGRAPGPPPPPGPRPPGGGPPPPP 1178 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GG PP PP G PP G P P PPP P GG PP Sbjct: 1020 GGAPPPPP----PPPMHGGAPPPPPPPPMHGGAPPP------PPPPPMHGGAPP 1063 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP--PXXXPPP 843 G G PPPP + PPPP P P PPP Sbjct: 1144 GPGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPP 1176 Score = 27.5 bits (58), Expect(2) = 4.3 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +1 Query: 763 PPPPXXFXKKKXXX---PPPPPPP 825 PPPP ++ PPPPPPP Sbjct: 816 PPPPFASVRRNSETLLPPPPPPPP 839 Score = 25.4 bits (53), Expect(2) = 4.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP P T Sbjct: 860 PPPPPPPPPFSPLNTT 875 >UniRef50_Q8LG30 Cluster: Adhesive/proline-rich-like protein; n=7; Magnoliophyta|Rep: Adhesive/proline-rich-like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 76 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP + PPPPPPP PPP+K Sbjct: 20 PPPPVGVPPQ--YYPPPPPPPPPPPPPRK 46 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 227 PPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPP 234 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 210 PPPPSPSPPPSPPPPPSPPPPPPPPPP 236 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPP 242 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPP 231 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPPP 233 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 227 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPSP 257 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPP 235 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP PPPPPPP PPP Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPP 241 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 233 PPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 234 PPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPPPSPP 258 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPP 236 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 211 PPPPFRDRPVASPSPPPPPPPPPPPPP 237 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PP PPPP PPP K Sbjct: 245 PPPPPPPPPPPPPPPPSPPPPSPNPPPPK 273 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPP 251 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPP 252 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPP 253 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPP 254 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 >UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=1; Arabidopsis thaliana|Rep: Uncharacterized protein At1g54215.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 169 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPP-PPPXXXPPPK 846 G PPPP K PPPP PPP PPPK Sbjct: 73 GIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPK 105 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPP 843 P F + PPPPPPP PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPP 58 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +F + PPPP PPPPPPP PPP Sbjct: 37 LFPQSPPPPPPPP------PPPPPPPPPPPPPPP 64 >UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os03g0308700 protein - Oryza sativa subsp. japonica (Rice) Length = 464 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP ++ PPPPP P G P P Sbjct: 291 PPPPPPPPPREMVAPPPPPPPPYYGQPTLAP 321 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P G P P Sbjct: 307 PPPPPPYYGQPTLAPPPPPPPPYCGHPTLAP 337 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP ++ PPPPPPP P Sbjct: 289 ATPPPPPPPPPREMVAPPPPPPPPYYGQP 317 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPP 825 A PPPP + + PPPPPPP Sbjct: 304 APPPPPPPPYYGQPTLAPPPPPPP 327 >UniRef50_A5C4F9 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 1064 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 750 PPPPLXKNLSTRAVPPPPPPPPPPPPP 776 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 749 PPPPPLXKNLSTRAVPPPPPPPPPPPP 775 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPP PPP Sbjct: 748 PPPPPPLXKNLSTRAVPPPPPPPPPPP 774 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPP 80 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPP 81 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPP PPP + Sbjct: 82 PPPPPPPPPPPPPPPPPPPPLPPPPPPSQ 110 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPP 82 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP PPPPPPP PPP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPP 83 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPLPP 104 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K + PPPPP P P P Sbjct: 499 PPPPPPPPSKSSGPPPPPPPPPKSSGPPPPP 529 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPP PPP Sbjct: 512 PPPPPPPPPKSSGPPPPPPPKSSPPPP 538 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP K PPPPPPP PPP Sbjct: 511 GPPPPPPP----PPKSSGPPPPPPPKSSPPP 537 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP--XXGXPXKKP 853 PPPPP K+ PPPPP P G P P Sbjct: 498 PPPPPPPPPSKSSGPPPPPPPPPKSSGPPPPPP 530 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 +G PPPP K PPPPP PP Sbjct: 510 SGPPPPPPPPPKSSGPPPPPPPKSSPPPP 538 >UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 866 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP F PP G PP G P P PPP P G PP Sbjct: 67 PPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPP 116 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 739 FFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 FF PP PPG P P PPP P GG PP Sbjct: 63 FFIPPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPP 106 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP F PP G PP F G P P PP P G PP Sbjct: 66 PPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPP 115 Score = 27.9 bits (59), Expect(2) = 7.4 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +F G G PPPP PPPPP PPP Sbjct: 89 MFAG-GIPPPPPMMG----GIPPPPPMFGAPPPP 117 Score = 24.2 bits (50), Expect(2) = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 547 KKXFFSLPPXGKKI*TPPXXXGGXPP 624 K FF PP PP GG PP Sbjct: 60 KPSFFIPPPVPNGFIPPPPGPGGIPP 85 >UniRef50_A1Z6X9 Cluster: CG11112-PB, isoform B; n=2; Drosophila melanogaster|Rep: CG11112-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 409 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPP + PPPPPPP PPP T Sbjct: 215 PPPFYKPSRPNRRPPPPPPPPPPPPPPPT 243 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP + + PPPPPP PPP Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPPPPPPP 239 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPPPPP PPP Sbjct: 215 PPPFYKPSRPNRRPPPPPPPPPPPPPP 241 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K+ PPPPPPP P +KT Sbjct: 549 PPPPLPGQHKQTPPPPPPPPPPPPLPGQKT 578 Score = 36.3 bits (80), Expect = 1.00 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + PPPPPPP PP Sbjct: 547 PPPPPPLPGQHKQTPPPPPPPPPPPP 572 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKK 850 PPPPP K PPPPP P P +K Sbjct: 548 PPPPPLPGQHKQTPPPPPPPPPPPPLPGQK 577 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXG 835 G PPPPP +K PPPPP P G Sbjct: 605 GPPPPPPPPLPGQKAGAPPPPPPPPPPG 632 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPP PPP Sbjct: 546 PPPPPPPLPGQHKQTPPPPPPPPPPPP 572 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPPP +K PPPPPPP Sbjct: 593 PPPPPPLPGQKTGPPPPPPPP 613 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPP 822 AG PPPP +K PPPPPP Sbjct: 591 AGPPPPPPLPGQKTGPPPPPPPP 613 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP--XXGXPXKKP 853 PPPPP K PPPPP P G P P Sbjct: 594 PPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPP 626 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 739 NIFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 N F PPPP K PPPPPPP PPP Sbjct: 802 NAFVPPPPPPPPPPGGSKTLPRPPPPPPP--PPPP 834 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 GA PPPP K PPPPPPP PP KT Sbjct: 853 GAPPPPPPPPPPGSKTGPPPPPPPP---PPGAKT 883 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP K PPPPP P P P Sbjct: 869 GPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPP 902 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K+ PPPPP P G P Sbjct: 827 PPPPPPPPGGKSAPPPPPPPPPPGGKGAPPP 857 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PPPP K PPPPPPP PP KT Sbjct: 839 APPPPPPPPPPGGKGAPPPPPPPP---PPGSKT 868 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 717 PPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPP 821 PP GG K PPPP K PPPPP Sbjct: 813 PPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPP 847 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 PPPP K PPPPPPP PPP Sbjct: 844 PPPPPPGGKGAPPPPPPPPPPGSKTGPPP 872 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P Sbjct: 857 PPPPPPPPGSKTGPPPPPPPPPPGAKTGSAP 887 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K PPPPPP PP K+ Sbjct: 809 PPPPPPPGGSKTLPRPPPPPPPPPPPGGKS 838 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 842 PPPPPPPPGGKGAPPPPPPPPP 863 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K PPPPPP PP KT Sbjct: 617 PPPPPSVPKSTNNSAPPPPPPPPPPPGGKT 646 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP PP Sbjct: 650 PPPPPPPGAKAGGPPPPPPPPGGKAPP 676 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 GA PPPP K PPPPPP PP Sbjct: 647 GAPPPPPPPPGAKAGGPPPPPPPPGGKAPP 676 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP K PPPPPPP P Sbjct: 647 GAPPPPPPPPGAKAGGPPPPPPPPGGKAP 675 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP 837 PPPP K PPPPPPP P Sbjct: 600 PPPPPPPPSAKSQVPPPPPPPPSVP 624 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPP PPP Sbjct: 616 PPPPPPSVPKSTNNSAPPPPPPPPPPP 642 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K+ PPPPP P Sbjct: 600 PPPPPPPPSAKSQVPPPPPPPP 621 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP N PPPPP P Sbjct: 617 PPPPPSVPKSTNNSAPPPPPPP 638 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 717 PPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPPXXXXAXPXKN 851 PP GG G PPPP K PPPPP A P N Sbjct: 640 PPPGGKT-----GAPPPPPPPPGAKAGGPPPPPPPPGGKAPPLPN 679 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP--XXGXPXKKP 853 PPPPP K PPPPP P G P P Sbjct: 635 PPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPP 667 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP ++N PPPPP P P P Sbjct: 332 PPPPPPIPGQQNPPPPPPPPLPGQQAPPPPP 362 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 295 PPPPLPNSTSNVTAPPPPPPPPPPPLP 321 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 312 PPPPPPPPLPNSQAPPPPPPPPPPPP 337 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPP PPP Sbjct: 354 GQQAPPPPPPLPGGARPPPPPPPPFGNAPPP 384 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP N PPPPP P Sbjct: 294 PPPPPLPNSTSNVTAPPPPPPP 315 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPP PPP Sbjct: 308 APPPPPPPPPPPLPNSQAPPPPPPPPPPPP 337 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 313 PPPPPPPLPNSQAPPPPPPPPPPPPIP 339 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 344 PPPPPPPPLPGQQAPPPPPPLPGGARPPPPP 374 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP K PPPP P P P Sbjct: 379 GNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPPP 412 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP PPP Sbjct: 293 PPPPPPLPNSTSNVTAPPPPPPPPPPP 319 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKK 850 PPPPP PPPPP P P ++ Sbjct: 313 PPPPPPPLPNSQAPPPPPPPPPPPPIPGQQ 342 >UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 996 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 948 PPPPPSLIPFGASPPPPPPPPPPPPPP 974 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 949 PPPPSLIPFGASPPPPPPPPPPPPPPP 975 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 947 PPPPPPSLIPFGASPPPPPPPPPPPPP 973 >UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 536 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 437 PPPPPPPPPSPPAPPPPPPPPVITPPP 463 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPPPP PPP T Sbjct: 438 PPPPPPPPSPPAPPPPPPPPVITPPPPPPT 467 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PP Sbjct: 433 APPPPPPPPPPPPSPPAPPPPPPPPVITPP 462 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 435 PPPPPPPPPPPSPPAPPPPPPPPVITPPPPP 465 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 436 PPPPPPPPPPSPPAPPPPPPPPVITPPPPPP 466 >UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2; Aspergillus|Rep: Contig An08c0110, complete genome - Aspergillus niger Length = 384 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXP--PP 843 G PPPP K PPPPPPP P PP Sbjct: 174 GPPPPPVSTRKPSAPAPPPPPPPSASPAAPP 204 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXP 826 + PPPPP K + PPPPP P Sbjct: 173 KGPPPPPVSTRKPSAPAPPPPPPP 196 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP-PPKK 849 PPPP PPPPPPP P PP+K Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPPRK 302 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPP 279 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 271 PPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPP 276 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP PPPPPPP PPP Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPP 274 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPP 280 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPP 281 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSP 299 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP PPPPP P P +KP Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP 303 >UniRef50_UPI0000E4A1BC Cluster: PREDICTED: similar to myosin XV; n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to myosin XV - Strongylocentrotus purpuratus Length = 2270 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP KK P PPPPP PP Sbjct: 1134 PPPPAPIIKKAPSPPSPPPPPPPQEPP 1160 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPP 262 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 259 PPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 260 PPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 261 PPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPP 252 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPP 281 >UniRef50_UPI0000DB6BDB Cluster: PREDICTED: similar to prickle CG11084-PA, isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar to prickle CG11084-PA, isoform A - Apis mellifera Length = 880 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPP------PPPPXXXPPP 843 AG PPPP F + PPP PPPP PPP Sbjct: 533 AGPPPPPPSFLRTGRRPPPPSEGSSSPPPPPPPPPP 568 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 37.1 bits (82), Expect = 0.57 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + PPPPPPP PP Sbjct: 547 PPPPPPLPSAEPPVPPPPPPPPGAPP 572 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP P P Sbjct: 548 PPPPPLPSAEPPVPPPPPPPPGAPPLP 574 >UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea nuclear polyhedrosis virus (HcNPV) Length = 539 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 240 PPPPTPPPPPPNMPPPPPPPPNMPPPP 266 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 253 PPPPPPPPNMPPPPPPPPPPPLSLPP 278 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 36.7 bits (81), Expect = 0.75 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPP PPP PPP Sbjct: 402 PPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G P PP PPPPPPP PPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSP 413 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPP 268 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 252 PPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 253 PPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 258 PPPPPPPSPPPPPPPPPPPPPPLLPP 283 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPP 267 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 249 PPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 250 PPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 259 PPPPPPSPPPPPPPPPPPPPPLLPPLP 285 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPP 271 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 257 PPPPPPPPSPPPPPPPPPPPPPPLLPP 283 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 430 PPPPPSPPPPPPPSPPPPPPPSPPPPP 456 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPP 464 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPP 300 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 308 PPPPPPSPPPPSPPPPSPPPPSPPPPP 334 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPP 357 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPP 401 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPP 455 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 437 PPPPPPSPPPPPPPSPPPPPPPSPPPP 463 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 445 PPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPP 515 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPP 265 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 240 PPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPP 283 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 258 PPPPSPPPPSPPPPSPPPPPPPSPPPP 284 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 268 PPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPP 317 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 292 PPPPSPPPPSPPPPSPPPPPPPSPPPP 318 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPP 323 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPPPP 341 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPPPP 385 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 360 PPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPP 439 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 414 PPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 423 PPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 473 PPPPSPPPPSPPPPSPPPPPPPSPPPP 499 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 522 PPPPSPPPPSPPPPSPPPPPPPSPPPP 548 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 527 PPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 250 PPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 268 PPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 283 PPPPPSPPPPPPPSPPPPSPPPPSPPP 309 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 284 PPPPSPPPPPPPSPPPPSPPPPSPPPP 310 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 302 PPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPP 333 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 340 PPPPPSPPPPPPPSPPPPSPPPPSPPP 366 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 341 PPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 346 PPPPPPPSPPPPSPPPPSPPPPSPPPP 372 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPP 400 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPP 410 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPP 416 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 423 PPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPP 454 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPP 457 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPP 462 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 454 PPPPPSPPPPPPPSPPPPSPPPPSPPP 480 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 455 PPPPSPPPPPPPSPPPPSPPPPSPPPP 481 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPP 486 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPP 514 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 498 PPPPPSPPPPPPPSPPPPSPPPPSPPP 524 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 499 PPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPP 530 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 532 PPPPSPPPPPPPSPPPPSPPPPSPPPP 558 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPP 42 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F PPP PPPPPPP PPP Sbjct: 11 FWRVDPPPPHCPPPPPPPPPPPPPPPPPPPPPP 43 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 791 PPPPLPPSPPPPPSPPPPPPPPSPPPP 817 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 832 PPPPPSSPPPPSPSPPPSPPPAPSPPP 858 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 809 PPPPSPPPPPNPPTPPSPPPPPSPPPP 835 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 815 PPPPNPPTPPSPPPPPSPPPPPSSPPP 841 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 792 PPPLPPSPPPPPSPPPPPPPPSPPPPP 818 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPP-PPPXXXPPP 843 PPPP PPPP PPP PPP Sbjct: 869 PPPPSPPPSPPPSPPPPPSPPPPPSPPP 896 >UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|Rep: CG1520-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 527 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPP 396 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPPPP 397 >UniRef50_Q94273 Cluster: Ground-like (Grd related) protein 6; n=2; Caenorhabditis|Rep: Ground-like (Grd related) protein 6 - Caenorhabditis elegans Length = 240 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P F PPPPPPP PPP Sbjct: 58 PPCPAQFCPPPPICPPPPPPPMPCPPP 84 >UniRef50_Q4QPX2 Cluster: IP05560p; n=1; Drosophila melanogaster|Rep: IP05560p - Drosophila melanogaster (Fruit fly) Length = 114 Score = 37.1 bits (82), Expect = 0.57 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F +++ P PPPP PPP Sbjct: 83 PPPPPQFRQRRQAPPGMPPPPDGLPPP 109 >UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 479 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPPPPP PPP KT Sbjct: 361 PPPPAA---AAPPPPPPPPPPAGLPPPPKT 387 >UniRef50_Q9C0F0 Cluster: Protein KIAA1713; n=33; Deuterostomia|Rep: Protein KIAA1713 - Homo sapiens (Human) Length = 1652 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 1422 PPPPPPPPPPPLALPPPPPPPPPLPPP 1448 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P P Sbjct: 1007 GGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPPP 1040 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 F G PPPP PPPPPPP P Sbjct: 1005 FSGGPPPPPPPPLPGFSGGAPPPPPPPMPGAP 1036 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXP-XXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 979 GPPPPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPP 1013 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 123 GRFMPPPPVLPGPPVGPPPPPPPPPPPPPPP 153 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 138 GPPPPPPP--PPPPPPPPPPPPPMAGPPP 164 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G P PPG P P K PPP P G PP Sbjct: 219 PPKGPPPPPHSPPGPPPAEGPPPPAK--VPPPAPPVEGPPP 257 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 155 PPPPMAGPPPPPGPPPPHPPPPAGPPP 181 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPP 165 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 149 PPPPPPPPPPMAGPPPPPGPPPPHPPP 175 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 150 PPPPPPPPPMAGPPPPPGPPPPHPPPP 176 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 37.1 bits (82), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 IF G PP PPPPPPP PPP Sbjct: 50 IFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPP 83 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP P PPPPP PPP++ Sbjct: 74 PPPPPPPPPPPPPPPSPPPPPPPPPPPQR 102 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSP 90 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPP 91 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 72 PPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 73 PPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 >UniRef50_A2EKU5 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 402 Score = 31.1 bits (67), Expect(2) = 0.73 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 276 PPPPPPPPPPPPP 288 Score = 24.6 bits (51), Expect(2) = 0.73 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 781 FXKKKXXXPPPPPPP 825 F + PPPPPPP Sbjct: 240 FSSYRIPPPPPPPPP 254 >UniRef50_UPI0000F2E28C Cluster: PREDICTED: similar to high-mobility group protein 2-like 1,; n=1; Monodelphis domestica|Rep: PREDICTED: similar to high-mobility group protein 2-like 1, - Monodelphis domestica Length = 627 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 371 PPPPTSTPFPGAVPPPPPPPPLPPPPP 397 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPP PPPPPPP PPP Sbjct: 366 GTSPAPPPPTSTPFPGAVPPPPPPPPLPPPP 396 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F + PPPPPPP PPP Sbjct: 505 PPPPSVFAGGQQQQPPPPPPP--PPPP 529 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 469 PPPPPTQSSAAGGGPPPPPPPPPPPTP 495 >UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein; n=1; Mycobacterium gilvum PYR-GCK|Rep: Integral membrane protein-like protein - Mycobacterium gilvum PYR-GCK Length = 335 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/54 (38%), Positives = 23/54 (42%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GG PP + PP Q+ PPG G P P PPP P GG PP Sbjct: 26 GGYPPPPPEGGYPPPPPAGGYQQPPPG---GAYPPPPGPGGYPPP-PGQGGYPP 75 Score = 33.1 bits (72), Expect = 9.3 Identities = 26/96 (27%), Positives = 32/96 (33%), Gaps = 3/96 (3%) Frame = -1 Query: 669 PXPXKKXXXPPPXPXXGXPPPXXGGXLNFFSXGGERKKXFFXPXGWXGG---PPXKXGTX 499 P P + PPP P G PPP G GG + P GG PP + G Sbjct: 20 PPPPSEGGYPPPPPEGGYPPPPPAGGYQQPPPGGA-----YPPPPGPGGYPPPPGQGGYP 74 Query: 498 XGXLXXXLXXNXLGGXLEPWGKKIXQXXGXXSKRLG 391 + GG P G+ G S +G Sbjct: 75 PPPGGYGMPPAGFGGGYPPPGQGYPPVGGPPSLDIG 110 >UniRef50_Q653X1 Cluster: Putative uncharacterized protein P0547F09.24; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0547F09.24 - Oryza sativa subsp. japonica (Rice) Length = 256 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 +G PPPP F PPPPPP PP Sbjct: 54 SGAPPPPAIFCPPPLSPPPPPPPIFYSPP 82 >UniRef50_Q9W2R5 Cluster: CG15225-PA; n=1; Drosophila melanogaster|Rep: CG15225-PA - Drosophila melanogaster (Fruit fly) Length = 239 Score = 36.7 bits (81), Expect = 0.75 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + PPPPPPP PP Sbjct: 188 PPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPP PPP Sbjct: 183 GQYPPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 >UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 1115 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 563 PPPPPLPQNLSGAPPPPPPPPPMLGGPPPPP 593 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 562 PPPPPPLPQNLSGAPPPPPPPPPMLGGPPP 591 >UniRef50_Q7PUD2 Cluster: ENSANGP00000013887; n=2; Culicidae|Rep: ENSANGP00000013887 - Anopheles gambiae str. PEST Length = 886 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP PPP Sbjct: 343 PPPPPM--PKSNIPPPPPPPPSLKPPP 367 >UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 603 Score = 36.7 bits (81), Expect = 0.75 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPPP F K PPPPPPP Sbjct: 410 PPPPPGFKSMKAPPPPPPPPP 430 >UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1164 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 572 GMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 602 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 433 PPPPPPPCPVPCPPPPPPPPPSPPPPP 459 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 431 PPPPPPPPPCPVPCPPPPPPPPPSPPP 457 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 436 PPPPCPVPCPPPPPPPPPSPPPPPPPP 462 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 434 PPPPPPCPVPCPPPPPPPPPSPPPPPP 460 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPP-PXXXPPP 843 PPPP PPPPPP P PPP Sbjct: 420 PPPPCPVPCPPPPPPPPPPPCPVPCPPP 447 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 435 PPPPPCPVPCPPPPPPPPPSPPPPPPP 461 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 512 PPPPPPGGMGGVPPPPPPPPPGGMPPP 538 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXP 841 G PPPPP PPPPP P G P Sbjct: 507 GAPPPPPPPPPGGMGGVPPPPPPPPPGGMP 536 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 1096 PPPPPPMPGMAGMPPPPPPPPPMPGMPGMPP 1126 Score = 33.9 bits (74), Expect = 5.3 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKP-PGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GG PP PP GG P P PG P P PPP P G PP Sbjct: 1058 GGPPPPPPPPPPPPPPPGGLPGAAPPMPG---AGGPPPPPPPPPPPPMPGMAGMPP 1110 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXG 835 G PPPPP PPPPP P G Sbjct: 1107 GMPPPPPPPPPMPGMPGMPPPPPPPMPG 1134 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPPPPP PPP T Sbjct: 1101 PPPPPPPGAIGLTAPPPPPPPPPPPPPLTT 1130 >UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1723 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 PPPPP PPPPP P G P K Sbjct: 1031 PPPPPPPPGMPGMPPPPPPPPPPPGMPGK 1059 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F G PPPP PPPPPPP PPP Sbjct: 1025 FGGPPPPPPPPPPPGMPGMPPPPPPPP---PPP 1054 >UniRef50_A5DP36 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 1440 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F PPPPP P PPP Sbjct: 1320 PPPPQSFAATVEDAPPPPPIPLQVPPP 1346 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F + PP PPPP PPP Sbjct: 1348 PPPPSLFPTESSNAPPAPPPP---PPP 1371 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 484 APPPPPPPPPLHAFVAPPPPPPPPPPPPPP 513 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 505 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 535 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 507 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 537 >UniRef50_O60885 Cluster: Bromodomain-containing protein 4; n=70; Coelomata|Rep: Bromodomain-containing protein 4 - Homo sapiens (Human) Length = 1362 Score = 36.7 bits (81), Expect = 0.75 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPP ++ PPPPPPP PPP++ Sbjct: 960 PPPHPSVQQQLQQQPPPPPPPQPQPPPQQ 988 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP +++ PPPPPP PP Sbjct: 959 PPPPHPSVQQQLQQQPPPPPPPQPQPP 985 >UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like - Strongylocentrotus purpuratus Length = 801 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPP P PPP Sbjct: 254 GAPPPPPPMMGGAPPPPPPPPGPGGAPPP 282 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 36.3 bits (80), Expect = 1.00 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPP PPP Sbjct: 914 PPPPPLLSEAPLPPPPPPPPQAALPPP 940 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPP + PPPPPPP PP Sbjct: 909 GAPPAPPPPPLLSEAPLPPPPPPPPQAALPP 939 >UniRef50_UPI0000DB7D01 Cluster: PREDICTED: similar to Wiskott-Aldrich syndrome (eczema-thrombocytopenia); n=1; Apis mellifera|Rep: PREDICTED: similar to Wiskott-Aldrich syndrome (eczema-thrombocytopenia) - Apis mellifera Length = 528 Score = 36.3 bits (80), Expect = 1.00 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 364 PPPPSLTSAPSLPPPPPPPPPPPPPP 389 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 364 PPPPSLTSAPSLPPPPPPPPPPPPPP 389 >UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 101.t00009 - Entamoeba histolytica HM-1:IMSS Length = 863 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 AG PPPP PPPPPPP PPP Sbjct: 28 AGAPPPP------SGGMPPPPPPPAGAPPP 51 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 AG PPPP PPPPPPP P P Sbjct: 300 AGPPPPPPPPPPLPNQVPPPPPPPPAPPLP 329 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP-PXXXPPP 843 G PPPP PPPPPP P PPP Sbjct: 290 GPPPPPPLPSAGPPPPPPPPPPLPNQVPPP 319 >UniRef50_Q117D5 Cluster: Putative uncharacterized protein precursor; n=1; Trichodesmium erythraeum IMS101|Rep: Putative uncharacterized protein precursor - Trichodesmium erythraeum (strain IMS101) Length = 358 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G G PPPP PPPPPPP PPP T Sbjct: 254 GPGFPPPPP---------PPPPPPPPPPPPPDTT 278 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP + PPPPPPP PPP Sbjct: 246 PSPPAQWRGPGFPPPPPPPPPPPPPPP 272 >UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Arabidopsis thaliana|Rep: Similarity to unknown protein - Arabidopsis thaliana (Mouse-ear cress) Length = 464 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP +++ PPPPPPP PPP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPP 45 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 R PPPPP ++ PPPPP P P +P Sbjct: 41 RAPPPPPPPLMRRRA--PPPPPPPPLPRPCSRP 71 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PPPP ++ PPPPP P P KT Sbjct: 42 APPPPPPPLMRRRAPPPPPPPPLPRPCSRPPKT 74 >UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr2 scaffold_140, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 1163 Score = 36.3 bits (80), Expect = 1.00 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP 837 PPPP K PPPPPPP P Sbjct: 565 PPPPPPISSNKAPSPPPPPPPPPLP 589 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 739 NIFXGAGXPPPPXXFXKK---KXXXPPPPPPPXXXPPP 843 ++ G PPPP F K PPPPPPP P P Sbjct: 626 SMLAGPPPPPPPPDFSSSSSNKPTLPPPPPPPPAPPLP 663 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPPP P Sbjct: 565 PPPPPPISSNKAPSPPPPPPPP 586 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G+ PPPP PPPPP P PPP Sbjct: 1541 GSSAPPPPPPPPPPPPPPPPPPPSPPPSPPP 1571 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PP P PPPPPPP PPP Sbjct: 1529 GKRTPPHPPPSSGSSAPPPPPPPPPPPPPPP 1559 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G P PP PPPPPPP PPP Sbjct: 1162 GQRPPSPPHPPPSSGSFTPPPPPPPPPPPPP 1192 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP PPPPPPP PPP Sbjct: 1534 PHPPPSSGSSAPPPPPPPPPPPPPPPP 1560 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 1536 PPPSSGSSAPPPPPPPPPPPPPPPPP 1561 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 1171 PPPSSGSFTPPPPPPPPPPPPPPPPPP 1197 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP F PPPPPPP PPP Sbjct: 1172 PPSSGSFTPPPPPPPPPPPPPPPPPPP 1198 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+ PPPP PPPPPPP PPP T Sbjct: 1176 GSFTPPPPPP------PPPPPPPPPPPPPPPSYT 1203 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 1536 PPPSSGSSAPPPPPPPPPPPPPPPPPP 1562 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G G PP PPPPPPP PPP Sbjct: 1527 GNGKRTPPHPPPSSGSSAPPPPPPPPPPPPP 1557 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP PPPPPPP PPP Sbjct: 1169 PHPPPSSGSFTPPPPPPPPPPPPPPPP 1195 >UniRef50_Q4QH65 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 885 Score = 36.3 bits (80), Expect = 1.00 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP ++ PPPPPPP PPP ++ Sbjct: 52 PPSPKLPSRRSAPPPPPPPPPPPPPPHRS 80 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PP P ++ PPPPPPP PP Sbjct: 52 PPSPKLPSRRSAPPPPPPPPPPPPPP 77 >UniRef50_A2E6V2 Cluster: WH2 motif family protein; n=3; Trichomonas vaginalis G3|Rep: WH2 motif family protein - Trichomonas vaginalis G3 Length = 422 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PPPP PPPPPPP PPP KT Sbjct: 286 AAAPPPPPP--------PPPPPPPGGLPPPPKT 310 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 586 PPPPPPPPPGGRLPPPPPPPPGGMPPP 612 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 575 PPPPGGSLTAPPPPPPPPPPGGRLPPP 601 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP + PPPPPP PPP Sbjct: 584 APPPPPPPPPPGGRLPPPPPPPPGGMPPPP 613 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 764 PPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP PPPPP P G P P Sbjct: 585 PPPPPPPPPPGGRLPPPPPPPPGGMPPPPP 614 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 574 PPPPPGGSLTAPPPPPPPPPPGGRLPP 600 >UniRef50_Q4UMI6 Cluster: Arp2/3 complex-activating protein rickA; n=10; Rickettsia|Rep: Arp2/3 complex-activating protein rickA - Rickettsia felis (Rickettsia azadi) Length = 526 Score = 36.3 bits (80), Expect = 1.00 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K N PPPPP P Sbjct: 330 PPPPPPPLSKNNILPPPPPPMP 351 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP KN PPPPP Sbjct: 329 PPPPPPPPLSKNNILPPPPP 348 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K PPPPP P P +T Sbjct: 331 PPPPPPLSKNNILPPPPPPMPTMAPAQTET 360 >UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit - Strongylocentrotus purpuratus Length = 1729 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F PPPPPPP PPP Sbjct: 1649 PPPPPPFGAA----PPPPPPPCGAPPP 1671 >UniRef50_UPI000023F6A5 Cluster: hypothetical protein FG10389.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG10389.1 - Gibberella zeae PH-1 Length = 1061 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP + PPPP PP PPP Sbjct: 799 GYPPPPPGPPRGLSTGPPPPGPPGPPPPP 827 >UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleostomi|Rep: Wiskott-Aldrich syndrome - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 479 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPP-----PPPPPXXXPPPKKT 852 +G PPPP K PP PPPPP PPP + Sbjct: 345 SGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPPPSSS 382 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPP PPP Sbjct: 335 PPPPAPHCNRSGPPPPPPPSQSHKPPP 361 >UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF16309, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 283 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 222 PPPPPLPISPSNGISPPPPPPPMTGSGFPPP 252 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP ++ PPPPP G P P Sbjct: 149 PPPPPTGVLDQSSTAPPPPPATGIGFPPPPP 179 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +1 Query: 751 GAGXPPPPXXFXK----KKXXXPPPPPPPXXXPP 840 G+G PPPP + PPPPPPP PP Sbjct: 246 GSGFPPPPPLNHSGSTGRLGRLPPPPPPPPPPPP 279 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 F PPPP PPP PPP PPP Sbjct: 202 FPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPP 234 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPP PP PPP T Sbjct: 233 PPPPPSPPPPSPPPPPPPSPPPPPPPPLPT 262 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 217 PPPPPPPPSPPPPSPPPPPPPSPPPP 242 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 231 PPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 232 PPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 215 PPPPPPPPPPSPPPPSPPPPPPPSPPP 241 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 216 PPPPPPPPPSPPPPSPPPPPPPSPPPP 242 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPP 246 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 221 PPPPSPPPPSPPPPPPPSPPPPSPPPP 247 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 2288 PPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 2555 PPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 2680 PPPPSPPPSPPPSPPPPSPPPPSPPPP 2706 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 2708 PPPPSPPPSPPPPSPPPPSPPPPSPPP 2734 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 2757 PPPPLPPAPSPPPSPPPPSPPPSPPPP 2783 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 231 PPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +F PPP PPPP PP PPP Sbjct: 2246 VFYNENSPPPSPPPPSPHPPSPPPPSPPPPSPPP 2279 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPP 2558 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 216 PPPPPPPPPSPPPPSPPPPPPPSPPPPSPPP 246 >UniRef50_A6G312 Cluster: Serine/threonine protein kinase; n=1; Plesiocystis pacifica SIR-1|Rep: Serine/threonine protein kinase - Plesiocystis pacifica SIR-1 Length = 424 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPP--PPPPXXXPPP 843 PPPP KKK PP PPPP PPP Sbjct: 340 PPPPPPGGKKKPPPPPGKRPPPPSGGPPP 368 >UniRef50_A5UZG1 Cluster: Protein kinase; n=4; Chloroflexaceae|Rep: Protein kinase - Roseiflexus sp. RS-1 Length = 599 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P + PPPPPPP PPP T Sbjct: 437 PPTPVPPTQAPVFVPPPPPPPPPPPPPTAT 466 >UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium sp. (strain KMS) Length = 317 Score = 35.9 bits (79), Expect = 1.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPP PPP Sbjct: 6 PPPPGNYPPPPQGGYPPPPPPGGYPPP 32 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFX-----GXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP GG P PPG + G P P PPP P G PP Sbjct: 6 PPPPGNYPPPPQGGYPPPP-PPGGYPPPPTQGGYPPPHPGGYPPPPPPQGGYPPP 59 >UniRef50_Q8RXR4 Cluster: Putative uncharacterized protein At4g14750; n=2; Arabidopsis thaliana|Rep: Putative uncharacterized protein At4g14750 - Arabidopsis thaliana (Mouse-ear cress) Length = 409 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP K PPPPPPP PPP Sbjct: 73 ATGPPPPACAITLKDSPPPPPPPP--PPPP 100 >UniRef50_O23331 Cluster: Putative uncharacterized protein; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein - Arabidopsis thaliana (Mouse-ear cress) Length = 314 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP K PPPPPPP PPP Sbjct: 51 ATGPPPPACAITLKDSPPPPPPPP--PPPP 78 >UniRef50_Q9VSQ1 Cluster: CG32030-PA, isoform A; n=9; Endopterygota|Rep: CG32030-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 1393 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPPP PPP Sbjct: 645 PEPLSPVKKPAAAPPPPPPPPPPPPP 670 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P K PPPPPPP PPP Sbjct: 645 PEPLSPVKKPAAAPPPPPPPPPPPPPP 671 >UniRef50_Q5C113 Cluster: SJCHGC03128 protein; n=4; Eukaryota|Rep: SJCHGC03128 protein - Schistosoma japonicum (Blood fluke) Length = 145 Score = 35.9 bits (79), Expect = 1.3 Identities = 25/70 (35%), Positives = 26/70 (37%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPPXXXXK 788 GG PP G G P K P W PP GG + GG PPP K Sbjct: 32 GGNPPKKG-GFPPKKKKTPRKIFPPKNPLKKNWNPPPPRGGPPPW---GGANPPPGGGKK 87 Query: 789 KKIXXXPPPP 818 K PPPP Sbjct: 88 GKNGGKPPPP 97 >UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 674 Score = 35.9 bits (79), Expect = 1.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + PPPPPPP PP Sbjct: 322 PPPPPPSPPRVPFLPPPPPPPPLSPP 347 >UniRef50_Q1HMI9 Cluster: Formin C; n=3; Trypanosoma cruzi|Rep: Formin C - Trypanosoma cruzi strain CL Brener Length = 937 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP KK PPPPPPP P Sbjct: 477 PPPPTSAGGKKGAPPPPPPPPSGAKKP 503 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G KKP Sbjct: 472 GPPPPPPPPTSAGGKKGAPPPPPPPPSG--AKKP 503 >UniRef50_A2FFZ7 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 142 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G PPPP K PPPPPPP P P++ Sbjct: 116 GAPPPP----SKSGAAPPPPPPPPPPPLPRR 142 >UniRef50_Q8WZK9 Cluster: Putative uncharacterized protein B14D6.190; n=1; Neurospora crassa|Rep: Putative uncharacterized protein B14D6.190 - Neurospora crassa Length = 1176 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +G PPP PPPPPPP PPP Sbjct: 955 SGPHPPPPPPVHYSHHAPPPPPPPPPPPPP 984 >UniRef50_A7ER22 Cluster: Predicted protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Predicted protein - Sclerotinia sclerotiorum 1980 Length = 420 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F PPPPPPP PPP Sbjct: 124 PPPPFSF----PPAPPPPPPPFSFPPP 146 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP F PPPPP PPP Sbjct: 119 APPPPPPPPFSFPPAPPPPPPPFSFPPPPP 148 >UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 1481 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 1396 PPPPPPPAFSAAAPPPPPPPPPVGGAPGGPP 1426 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPP----PXXXPPP 843 A PPPP F PPPPPP P PPP Sbjct: 1395 APPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPPP 1428 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +G PPPP PPPPPPP P P Sbjct: 356 SGPPPPPPSVLGVGPVAPPPPPPPPPPPGP 385 >UniRef50_Q00486 Cluster: Mini-collagen precursor; n=2; Hydra sp.|Rep: Mini-collagen precursor - Hydra sp Length = 186 Score = 28.3 bits (60), Expect(2) = 1.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 163 PPPPPPPPPPPP 174 Score = 26.6 bits (56), Expect(2) = 1.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G G P PP PP PPPP Sbjct: 119 GPGMPGPPGPPGPPGIPAPPAPPPP 143 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGX-FXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP G P PP G P P PPP P G PP Sbjct: 668 PPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP 718 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP PP G P PP G P P PPP P G P Sbjct: 679 PPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGGFGFRP 728 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXG-XXPXPXXKXXXPPPXPXXGGXPP 608 PP PP G P PP G P P PPP P G PP Sbjct: 658 PPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPP 708 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -3 Query: 730 PPXG--GXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G G P PPG P P PPP P G PP Sbjct: 645 PPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPP 687 >UniRef50_UPI000023DB29 Cluster: hypothetical protein FG02238.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG02238.1 - Gibberella zeae PH-1 Length = 1043 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP + PPPPPP PPP Sbjct: 349 APPPPPPPQAPQGHVSSAPPPPPPPPGPPP 378 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPPPPP PP T Sbjct: 353 PPPPQAPQGHVSSAPPPPPPPPGPPPVLST 382 >UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n=1; Bos taurus|Rep: UPI0000F30E84 UniRef100 entry - Bos Taurus Length = 921 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 777 PPPPPPLALPPPPPPPPPPPPPPLPP 802 >UniRef50_Q6NXC1 Cluster: Zgc:56141; n=4; Clupeocephala|Rep: Zgc:56141 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 341 Score = 35.5 bits (78), Expect = 1.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G P P + + + PP PPPP PPP+++ Sbjct: 170 GERPEPPGYPRGRYGYPPGPPPPPPPPPPRRS 201 >UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 430 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP F + PP PPPP PP Sbjct: 135 PPPPSPFAPEPSPPPPMPPPPTPPPP 160 >UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1; Methylobacterium sp. 4-46|Rep: Putative uncharacterized protein - Methylobacterium sp. 4-46 Length = 980 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPP PPP PPP Sbjct: 724 GVTPPPPPPPAPPLPPPAPPPAPPPAPPPPP 754 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 739 NIFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 N+ G PPPP PPP PP PPP Sbjct: 719 NVAQGGVTPPPPPPPAPPLPPPAPPPAPPPAPPPP 753 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 PPPPP K+ PPPPP P P K Sbjct: 460 PPPPPAVMPLKHFAPPPPPPLPPAVMPLK 488 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 736 KNIFXGAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 K + A PPPP PPPPPPP PPP Sbjct: 501 KPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPP 538 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP PPPPPPP Sbjct: 589 GPPPPPPPMPLANGATPPPPPPP 611 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPP 825 A PP P F K PPPPPPP Sbjct: 491 APPPPTPPAFKPLKGSAPPPPPPP 514 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXG 835 G PPPPP N PPPP P G Sbjct: 602 GATPPPPPPPMAMANGAAGPPPPPPRMG 629 >UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class, expressed; n=4; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class, expressed - Oryza sativa subsp. japonica (Rice) Length = 675 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 37 PPPPPPTPSSPQRPPPPPPPATPPPPP 63 >UniRef50_Q0JDV1 Cluster: Os04g0373000 protein; n=2; Magnoliophyta|Rep: Os04g0373000 protein - Oryza sativa subsp. japonica (Rice) Length = 389 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP + P PPPPP PPP + Sbjct: 49 PPPPSLPTTPRSPPPSPPPPPPPPPPPSSS 78 >UniRef50_Q013S1 Cluster: Chromosome 08 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 08 contig 1, DNA sequence - Ostreococcus tauri Length = 736 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PP PPPP PPP T Sbjct: 687 PPPPSPPPPPSPPPPPSPPPPPSPPPPSGT 716 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 933 PPPPPPVPSPPPPSPPPPSPPPLPPPP 959 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 942 PPPPSPPPPSPPPLPPPPPPPSPPPP 967 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 884 PPPPSPPPPSPLPSPPPPSPPSPSPPP 910 >UniRef50_Q7JRM9 Cluster: GH11283p; n=20; Eumetazoa|Rep: GH11283p - Drosophila melanogaster (Fruit fly) Length = 324 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 22 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 70 >UniRef50_Q5BZA5 Cluster: SJCHGC07445 protein; n=1; Schistosoma japonicum|Rep: SJCHGC07445 protein - Schistosoma japonicum (Blood fluke) Length = 113 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPPKK 849 +KK PPPPP P PPPKK Sbjct: 50 RKKGKTPPPPPKPKKNPPPKK 70 >UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; Dictyostelium discoideum|Rep: Wiscott-Aldrich syndrome protein - Dictyostelium discoideum AX4 Length = 399 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G G PPPP PPPPPP PP Sbjct: 290 GGGAPPPPPPPPPPSSGPPPPPPPMASAPP 319 >UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; Suberites domuncula|Rep: Wiskott-Aldrich syndrome protein - Suberites domuncula (Sponge) Length = 410 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP---PXXXPPP 843 G G PPPP PPPPPP P PPP Sbjct: 293 GRGGPPPPSNSRGGSAPAPPPPPPVGVPAPPPPP 326 >UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_73, whole genome shotgun sequence - Paramecium tetraurelia Length = 442 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 734 KKIYXXGRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 K I PPPPP PPPPP G P KP Sbjct: 66 KVIVNKAAPPPPPPPPPPPPPKGAPPPPPPRPPGPPAAKP 105 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K PPPPP P P K T Sbjct: 77 PPPPPPPPPPKGAPPPPPPRPPGPPAAKPT 106 >UniRef50_A0CNK9 Cluster: Chromosome undetermined scaffold_22, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_22, whole genome shotgun sequence - Paramecium tetraurelia Length = 992 Score = 35.5 bits (78), Expect = 1.7 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP+KT Sbjct: 529 PPPPPPPPPPPPPQKT 544 >UniRef50_Q2H9M3 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 346 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 736 KNIFXG-AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +++F G A PPP PPPPPPP PPP Sbjct: 171 RHVFLGRACLLPPPPSPPAAPPQTPPPPPPPTNPPPP 207 >UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 592 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P P P Sbjct: 213 PPPPPSNPPGGNLRAPPPPPPPPAAPPRPVP 243 >UniRef50_A4RAI7 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 645 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 ++ G PPPP PPPPPPP PPP K Sbjct: 326 LYRGPTPPPPPPP--------PPPPPPPRPRPPPPK 353 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPK 846 P F + PPPPPPP PPP+ Sbjct: 320 PKDFHFLYRGPTPPPPPPPPPPPPPPR 346 >UniRef50_A3LN86 Cluster: Protein involved in actin organization and endocytosis; n=2; Saccharomycetales|Rep: Protein involved in actin organization and endocytosis - Pichia stipitis (Yeast) Length = 1373 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 1299 PPGPPPIPNAPFGAPPPPPPPPGPPPP 1325 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 1278 PPIPVGGPSSFAPPPPPPPPPPPGPPP 1304 >UniRef50_A3GHT1 Cluster: Predicted protein; n=3; Saccharomycetaceae|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 1790 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +1 Query: 754 AGXPPPPXXFX----KKKXXXPPPPPPPXXXPPP 843 A PPPP F + PPPPPPP PPP Sbjct: 1131 APPPPPPPPFPTSLVQNGSGGPPPPPPPPPPPPP 1164 >UniRef50_A2R7D2 Cluster: Contig An16c0100, complete genome; n=1; Aspergillus niger|Rep: Contig An16c0100, complete genome - Aspergillus niger Length = 692 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 141 PPPPPPHPHPHHHYPPPPPPPPHHPP 166 >UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Protein piccolo - Homo sapiens (Human) Length = 5183 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP--PKKT 852 PPPP PPPPPPP PP PK T Sbjct: 2336 PPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPT 2367 >UniRef50_A5DQ05 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 1460 Score = 27.5 bits (58), Expect(2) = 1.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PPP + Sbjct: 1421 PPPPPPP--PPPPSR 1433 Score = 26.6 bits (56), Expect(2) = 1.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPP 825 PP ++ PPPPPPP Sbjct: 1411 PPSRGSSEQVPPPPPPPPP 1429 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPP----XXXPPP 843 +G PPPP + PPPPPPP PPP Sbjct: 581 SGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPP 614 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXP--XXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 582 GPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPPP 617 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXP--XXGXPXKKP 853 G PPPPP + PPPPP P G P P Sbjct: 596 GPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPP 631 >UniRef50_UPI00015B5935 Cluster: PREDICTED: similar to prIL-16; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to prIL-16 - Nasonia vitripennis Length = 2151 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P K+ PPPPPPP PPP Sbjct: 485 PMPRKELKAKRKRPPPPPPPPRREPPP 511 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPPP F PPPPP P PPP Sbjct: 464 GAPPPPPPPPF---PGGVPPPPPLPGGAPPP 491 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 766 GGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGG 617 GG PP P GG P PP G P P PPP P GG Sbjct: 476 GGVPPPP-----PLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPPIGG 520 Score = 33.5 bits (73), Expect = 7.0 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-GGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 G GG PP PP GG P PG P P PP P GG PP Sbjct: 461 GMGGAPPPPP---PPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPP 513 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP P P Sbjct: 419 APPPPPPPPPLPPGVGAPPPPPPPPPPPLP 448 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 439 PPPPPPPPLPGGSCIPPPPPPPGMGGAPPPP 469 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP-PXXXPPP 843 G+ PPPP PPPPPP P PPP Sbjct: 450 GSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPP 481 >UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF13974, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 692 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 122 PPPPLPSFTLSPPPPPPPPPPPPLPP 147 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPP F PPPPPPP P P+ Sbjct: 123 PPPLPSFTLSPPPPPPPPPPPPLPPSPR 150 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 120 PPPPPPLPSFTLSPPPPPPPPPPPPLP 146 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 118 PPPPPPPPLPSFTLSPPPPPPPPPPPP 144 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P +P Sbjct: 121 PPPPPLPSFTLSPPPPPPPPPPPPLPPSPRP 151 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F P PPPP PPP Sbjct: 206 PPPPSPFPPSPPPSPAPPPPSPLPPPP 232 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 692 PPPPSPPPPSPPSPPPPSPPPPPSPPP 718 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 1229 PPPPSPPPSPPPPSPPPTPPPPLSPPP 1255 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPP--PPPPXXXPPP 843 PPPP PPP PPPP PPP Sbjct: 499 PPPPPPSPPPSPFLPPPSLPPPPPPSPPP 527 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 1702 PPPPASPPLLPPAPPSPPPPPDPAPPP 1728 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPP 223 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 58 PPPPLPPPSPSPPSPPPPSPPPPSPPP 84 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 206 PPPPSPPPPSPPPPPPPPPPPPPSPP 231 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 211 PPPPSPPPPPPPPPPPPPSPPSPNPPP 237 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 148 PPPPPWWQAPSASPSPPPPPPPWWQAPSASP 178 >UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, periplasmic energy transduction protein TonB; n=1; Myxococcus xanthus DK 1622|Rep: Ferric siderophore transporter, periplasmic energy transduction protein TonB - Myxococcus xanthus (strain DK 1622) Length = 269 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +F PPPP K PPPPP P P P Sbjct: 64 VFRPPPPPPPPPVVEAKPPPPPPPPPKPKLAPKP 97 >UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; Acidiphilium cryptum JF-5|Rep: Putative uncharacterized protein - Acidiphilium cryptum (strain JF-5) Length = 320 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K PP PPPP P P T Sbjct: 92 PPPPAPHAAPKLPQPPVPPPPPPPPTPAPT 121 >UniRef50_A3WE37 Cluster: Putative uncharacterized protein; n=2; Erythrobacter sp. NAP1|Rep: Putative uncharacterized protein - Erythrobacter sp. NAP1 Length = 371 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP KK PPP PPP P P KT Sbjct: 325 PPPP----KKPPMKPPPKPPPKPPPKPPKT 350 >UniRef50_A2SK16 Cluster: Putative uncharacterized protein; n=1; Methylibium petroleiphilum PM1|Rep: Putative uncharacterized protein - Methylibium petroleiphilum (strain PM1) Length = 167 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPP P PPP Sbjct: 30 PPPPAPAPVQAPIQPPPPPAPPPPPPP 56 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 29 PPPPPAPAPVQAPIQPPPPPAPPPPPPPPAP 59 >UniRef50_A0M294 Cluster: BlaR1-like family M56 peptidase; n=1; Gramella forsetii KT0803|Rep: BlaR1-like family M56 peptidase - Gramella forsetii (strain KT0803) Length = 671 Score = 35.1 bits (77), Expect = 2.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPP 820 G PPPPP ++N PPPPP Sbjct: 396 GTPPPPPPPPVQRRNGNVPPPPP 418 >UniRef50_A0J0A0 Cluster: Putative lipoprotein precursor; n=2; Alteromonadales|Rep: Putative lipoprotein precursor - Shewanella woodyi ATCC 51908 Length = 508 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPPPPP PPP +T Sbjct: 38 PPPPPP----PPPPPPPPPPPPPPPPPPET 63 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 G PPPP KK PPPPPP PPK Sbjct: 404 GPAAPPPPPP-PGKKGAGPPPPPPMSKKGPPK 434 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 A PPPP KK PPPPPPP PPP Sbjct: 392 AAAPPPPPP-PKKGPAAPPPPPPPGKKGAGPPP 423 >UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhardtii|Rep: PF6 protein - Chlamydomonas reinhardtii Length = 2301 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP + PPPPPP PPP Sbjct: 480 APPPPPPPPPEPEPEPTPPPPPPAGPMPPP 509 >UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg protein - Ostreococcus tauri Length = 3738 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 20 PPPPSPAPPSPPPPPPSPPPPSPPPPP 46 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 14 PPPPSPPPPPSPAPPSPPPPPPSPPPP 40 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 19 PPPPPSPAPPSPPPPPPSPPPPSPPPP 45 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPPP PPP Sbjct: 13 PPPPPSPPPPPSPAPPSPPPPPPSPPP 39 >UniRef50_Q01B16 Cluster: Chromosome 04 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 04 contig 1, DNA sequence - Ostreococcus tauri Length = 1138 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PPP PPPPPPP PP KT Sbjct: 618 ASPPPPSPSPPPPPPPSPPPPPPPSPPPPGAKT 650 >UniRef50_A5B8N9 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 136 Score = 35.1 bits (77), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PPPKK Sbjct: 64 PPPPPPPSPPPPPKK 78 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 677 GVPPPPPP----PGGVPPPPPPPGGVPPP 701 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GG P + PP GG P PPG P P PPP P PP Sbjct: 659 GGAPAAPGLVPPPPPPPGGVPPPPPPPGGV--PPPPPPPGGVPPPPAPPGVPAPP 711 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 669 PPPPPP----PGGVPPPPPPPGGVPPP 691 >UniRef50_Q2GVY3 Cluster: Putative uncharacterized protein; n=2; Pezizomycotina|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 830 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 433 PPPPSPAKTPPPATPPPPPPPPPPPP 458 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP K PPPPPP PPP Sbjct: 433 PPPPSPAKTPPPATPPPPPPPPPPPP 458 >UniRef50_P33485 Cluster: Probable nuclear antigen; n=5; root|Rep: Probable nuclear antigen - Pseudorabies virus (strain Kaplan) (PRV) Length = 1733 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPPP PP Sbjct: 271 PPPPSPPPRPPPPLPPPPPPPPPPQPP 297 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 272 PPPSPPPRPPPPLPPPPPPPPPPQPPP 298 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 1020 PPPPPAHPGLSGAAPPPPPPPPPPPP 1045 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPPP PPPPP PPP Sbjct: 1031 GAAPPPPPPPPPPPPGAGAAPPPPPPPPPPP 1061 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 1019 PPPPPPAHPGLSGAAPPPPPPPPPPPP 1045 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPP PPP Sbjct: 1033 APPPPPPPPPPPPGAGAAPPPPPPPPPPPP 1062 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 G GG PP GG P PPG F G P P PPP G PP Sbjct: 1064 GLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPP-----PPPPGGAFGVPPP 1113 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP G P P Sbjct: 1067 GPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPP 1100 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 678 PKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPP 821 P PGGF PP GG GG PPPP PPPPP Sbjct: 1073 PPPPPGGFGGPPPPPPPPGGF------GGPPPPPPPPPGGAFGVPPPPPP 1116 >UniRef50_A4FBY5 Cluster: Putative uncharacterized protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative uncharacterized protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 394 Score = 31.5 bits (68), Expect(2) = 2.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPP--PPPXXXPPP 843 G PPPP PPP PPP PPP Sbjct: 209 GPSKPPPPPPVTPPPPPVTPPPVTPPPPVTPPP 241 Score = 22.2 bits (45), Expect(2) = 2.7 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +1 Query: 565 LPPXGKKI*TPPXXXGGXPPLXV 633 LPP + + PP G PP+ + Sbjct: 176 LPPPPRPLPLPPPPLPGKPPIDI 198 >UniRef50_UPI0000F2D09F Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 91 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 42 PPEPGAAEPPAPPRPPPPPPPPPPPPP 68 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 GA PP P PPPPPPP PPP ++ Sbjct: 46 GAAEPPAPPR------PPPPPPPPPPPPPPPARS 73 >UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous 1; n=1; Monodelphis domestica|Rep: PREDICTED: similar to diaphanous 1 - Monodelphis domestica Length = 1186 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PP Sbjct: 592 GINVPPPPPLPGSISIPPPPPPPPPLPVLPP 622 >UniRef50_UPI0000F2B0FD Cluster: PREDICTED: similar to peroxisome proliferative activated receptor, gamma, coactivator-related 1,; n=1; Monodelphis domestica|Rep: PREDICTED: similar to peroxisome proliferative activated receptor, gamma, coactivator-related 1, - Monodelphis domestica Length = 1502 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G G PP PPPPPPP PPP Sbjct: 790 GPGPQPPYWPAVPPTPLPPPPPPPPPPPPPP 820 >UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1493 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 859 PPPPQAVPPPPLQAVPPPPPPQAVPPP 885 >UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1331 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G G PPPP PPPP P PPP Sbjct: 831 GMGAPPPPPPLPGLSAPPPPPPLPGMGVPPP 861 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPPP PPPP P PPP Sbjct: 807 GASLPPPPPPLPCLSVPPPPPPLPGMGAPPP 837 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G G PPPP PPPPPPP Sbjct: 855 GMGVPPPPPPPLTHTGPAPPPPPPP 879 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 833 GAPPPPPPLPGLSA---PPPPPPLPGMGVPPPPP 863 >UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: actin binding protein - Entamoeba histolytica HM-1:IMSS Length = 986 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP--PXXXPPP 843 G PPPP PPPPPP P PPP Sbjct: 514 GVPPPPPGVPGATGVPPPPPPPGMPGAPPPP 544 >UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n=2; Danio rerio|Rep: UPI00015A5D5E UniRef100 entry - Danio rerio Length = 1093 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G G PPPP PPPP P PPP Sbjct: 904 GMGAPPPPPPLPGLSAPPPPPPLPGMGVPPP 934 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPPP PPPP P PPP Sbjct: 880 GASLPPPPPPLPCLSVPPPPPPLPGMGAPPP 910 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G G PPPP PPPPPPP Sbjct: 928 GMGVPPPPPPPLTHTGPAPPPPPPP 952 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP P G P P Sbjct: 906 GAPPPPPPLPGLSA---PPPPPPLPGMGVPPPPP 936 >UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropicalis|Rep: LOC779576 protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 1222 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 739 NIFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 ++F PPPP PPPPPPP PP Sbjct: 903 SLFGSGIPPPPPLPNGISILNAPPPPPPPPPLPP 936 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G+G PPPP PPPPPP PP Sbjct: 906 GSGIPPPPPLPNGISILNAPPPPPPPPPLPP 936 >UniRef50_Q3V4U6 Cluster: Putative uncharacterized protein; n=1; Acidianus two-tailed virus|Rep: Putative uncharacterized protein - Acidianus two-tailed virus Length = 1940 Score = 34.7 bits (76), Expect = 3.0 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP KT Sbjct: 1869 PPPPPPPPPPPPPPKT 1884 >UniRef50_Q8XTG7 Cluster: Probable prolin-rich transmembrane protein; n=2; Ralstonia solanacearum|Rep: Probable prolin-rich transmembrane protein - Ralstonia solanacearum (Pseudomonas solanacearum) Length = 170 Score = 34.7 bits (76), Expect = 3.0 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPPK T Sbjct: 85 PPPPPPPPPAPPPKPT 100 >UniRef50_Q5YRU1 Cluster: Putative serine/threonine protein kinase; n=1; Nocardia farcinica|Rep: Putative serine/threonine protein kinase - Nocardia farcinica Length = 942 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 GAG PPPP F PPP PPP P P+ Sbjct: 695 GAGAPPPPGGF-----SGPPPYPPPAHPPRPR 721 >UniRef50_A0L6N7 Cluster: Putative uncharacterized protein precursor; n=1; Magnetococcus sp. MC-1|Rep: Putative uncharacterized protein precursor - Magnetococcus sp. (strain MC-1) Length = 322 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXX--PPPPPPPXXXPPP 843 GAG PPPP PPPPPPP PPP Sbjct: 292 GAGAPPPPQGMGLDPLHKILPPPPPPP--PPPP 322 >UniRef50_A0ADW6 Cluster: Putative secreted proline-rich protein; n=1; Streptomyces ambofaciens ATCC 23877|Rep: Putative secreted proline-rich protein - Streptomyces ambofaciens ATCC 23877 Length = 193 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 P P PPPPPPP PPP+K Sbjct: 77 PTPTPTPTPPPPKPPPPPPPAPEPPPRK 104 >UniRef50_Q9XIP3 Cluster: Putative uncharacterized protein At2g27390; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein At2g27390 - Arabidopsis thaliana (Mouse-ear cress) Length = 134 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP ++ PPPPPPP PPP Sbjct: 89 PPPLLPPPEEPPREPPPPPPPPEEPPP 115 >UniRef50_Q9XIB6 Cluster: F13F21.7 protein; n=5; core eudicotyledons|Rep: F13F21.7 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 847 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F PPPP P PPP Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPP 620 >UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Rep: F9F8.15 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 451 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPP 90 >UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thaliana|Rep: F14J22.4 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 494 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP PPPP PP PPP+ Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQ 93 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPP 97 >UniRef50_Q9FJX6 Cluster: Formin-like protein; n=1; Arabidopsis thaliana|Rep: Formin-like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 899 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPP 392 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPPPPP PPP Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPP 393 >UniRef50_Q6NMD9 Cluster: At1g02405; n=1; Arabidopsis thaliana|Rep: At1g02405 - Arabidopsis thaliana (Mouse-ear cress) Length = 134 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP KK PP P PP PPP Sbjct: 64 PPPPSPPPPKKSSCPPSPLPPPPPPPP 90 >UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=3; Oryza sativa (japonica cultivar-group)|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 1779 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPPPPP P P KT Sbjct: 1380 PPPPPA--APSPLAPPPPPPPPCPPAPPKT 1407 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 375 PPPPPASSPPPPPRPPPPSPPPSPPPP 401 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP PPP PPP PP Sbjct: 373 ASPPPPPASSPPPPPRPPPPSPPPSPPPP 401 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPP PPP PPP K Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPCK 260 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP P PPPPP PPP Sbjct: 185 PPPPPSPPPPSPPPPSPPPPPPPSPPP 211 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 186 PPPPSPPPPSPPPPSPPPPPPPSPPPP 212 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 187 PPPSPPPPSPPPPSPPPPPPPSPPPPP 213 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPP 203 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 178 PPPPSPPPPPPPSPPPPSPPPPSPPPP 204 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 203 PPPPPSPPPPPPPSPPPPSPPPPSPPP 229 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 204 PPPPSPPPPPPPSPPPPSPPPPSPPPP 230 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PPP PPP Sbjct: 209 PPPPPPPSPPPPSPPPPSPPPPSPPPP 235 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 75 PPPSVTSSPPPPPLPPPPPPPAASPPP 101 >UniRef50_Q10MK2 Cluster: Glycosyltransferase 5, putative, expressed; n=4; Oryza sativa|Rep: Glycosyltransferase 5, putative, expressed - Oryza sativa subsp. japonica (Rice) Length = 483 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 80 PPSPPSSSPPPLSFPPPPPPPSSPPPP 106 >UniRef50_Q9VEP4 Cluster: CG5225-PA; n=2; Drosophila melanogaster|Rep: CG5225-PA - Drosophila melanogaster (Fruit fly) Length = 594 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G G P PP PPPPPPP PP Sbjct: 222 GTGPPGPPGPPGTTYPQPPPPPPPPPPPPP 251 >UniRef50_Q9VC76 Cluster: CG13615-PA; n=2; Sophophora|Rep: CG13615-PA - Drosophila melanogaster (Fruit fly) Length = 290 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPP 843 P K K PPPPPPP PPP Sbjct: 62 PRHVGKPKAKLPPPPPPPPPPPPP 85 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPP 843 K K PPPPPPP PPP Sbjct: 69 KAKLPPPPPPPPPPPPPPP 87 >UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000013088 - Anopheles gambiae str. PEST Length = 157 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXX--PPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 44 GPPPPPRPVYGPPPVHHAPPPPPPPAYGPPP 74 >UniRef50_Q4QIK8 Cluster: Putative uncharacterized protein; n=2; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 352 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPP PP PPP Sbjct: 299 PPPPHLTAPFRETVPPPPGPPPPPPPP 325 >UniRef50_Q4DD93 Cluster: Putative uncharacterized protein; n=3; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 1447 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPP F PPPPPPP PP Sbjct: 249 PPPQGAFYLAPHGMPPPPPPPPPPPP 274 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 248 PPPPQGAFYLAPHGMPPPPPPPPPPPP 274 >UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Diaphanous - Aedes aegypti (Yellowfever mosquito) Length = 1014 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPPPP G P P Sbjct: 439 GMGPPPPPPPPGSGGGMPPPPPPPMMPGVPMPPP 472 >UniRef50_A7TDC9 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 195 Score = 34.7 bits (76), Expect = 3.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP +++ PPPP PP PP Sbjct: 147 PPPPPKGRRRQKDLPPPPEPPPPPPP 172 >UniRef50_A2D8Z8 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 340 AAAPPPPPP---PAANLPPPPPPPANLPPP 366 >UniRef50_Q871Q2 Cluster: Putative uncharacterized protein B11C21.020; n=1; Neurospora crassa|Rep: Putative uncharacterized protein B11C21.020 - Neurospora crassa Length = 425 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 AG PPPP PPPPPPP PPP Sbjct: 312 AGPPPPPP---------PPPPPPPPPPPPP 332 >UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; Basidiomycota|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 464 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 324 PPPPPPPPARPPGGAPPPPPPPPTSAPSAPP 354 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 310 PPPPVRSDGTGVAPPPPPPPPPARPP 335 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 309 PPPPPVRSDGTGVAPPPPPPPPPARPP 335 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP---PXXXPPP 843 G G PPPP PPPPPP P PPP Sbjct: 962 GVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPP 995 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP G P P Sbjct: 966 PPPPPPPPGMGGPPPPPPPPGAGPGGPPPPP 996 >UniRef50_A6QY38 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 923 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 736 KNIFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 KNIF G PP PPPPPPP PP K+ Sbjct: 446 KNIF-GLDEGSPPVQHPGMIYPPPPPPPPPSQLPPSSKS 483 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PP Sbjct: 248 PPPPPPPPSSSLPPPPPPPPPSSTRPP 274 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 249 PPPPPPPSSSLPPPPPPPPPSSTRPPP 275 >UniRef50_A0JLT2 Cluster: Mediator of RNA polymerase II transcription subunit 19; n=31; Euteleostomi|Rep: Mediator of RNA polymerase II transcription subunit 19 - Homo sapiens (Human) Length = 244 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P P Sbjct: 14 PPPPPTALGFGPGKPPPPPPPPAGGGPGTAP 44 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G+ P PP PPPPPPP PPP Sbjct: 886 GSLSPAPPMPPVSAGPPLPPPPPPPPPLPPP 916 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP 837 PPPP PPPPPPP P Sbjct: 907 PPPPPPLPPPSSAGPPPPPPPPPLP 931 >UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana tabacum|Rep: Extensin precursor - Nicotiana tabacum (Common tobacco) Length = 620 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 450 PPPPTYSPPPPAYAQPPPPPPTYSPPP 476 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP + PPPP P PPP Sbjct: 463 AQPPPPPPTYSPPPPAYSPPPPSPIYSPPP 492 >UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Protein enabled - Drosophila melanogaster (Fruit fly) Length = 829 Score = 34.7 bits (76), Expect = 3.0 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 603 Query: 616 XPP 608 PP Sbjct: 604 GPP 606 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP P P Sbjct: 577 GPPPPPPPPPPLPNQAPPPPPPPPAPPLP 605 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP-PXXXPPP 843 G PPPP PPPPPP P PPP Sbjct: 566 GPPPPPPLPSTGPPPPPPPPPPLPNQAPPP 595 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PPP Sbjct: 438 GPAAPPPPPP-------PPPPPPPPPLPPPP 461 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 568 PPPPPLPSTGPPPPPPPPPPLPNQAPPPPPP 598 >UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep: Protein enabled homolog - Homo sapiens (Human) Length = 591 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPP P PPP Sbjct: 335 GPPPPPPLPSTGPPPPPPPPPLPNQVPPP 363 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP N PPPPP P P Sbjct: 347 PPPPPPPPPLPNQVPPPPPPPPAPPLP 373 >UniRef50_A4R2D8 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 1587 Score = 28.7 bits (61), Expect(2) = 3.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPPP + + PPPPPP Sbjct: 1409 PPPPPVLKELQHLAIPPPPPP 1429 Score = 24.6 bits (51), Expect(2) = 3.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP P Sbjct: 1465 PPPPPPPMTMSAP 1477 >UniRef50_A7QDU5 Cluster: Chromosome chr4 scaffold_83, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr4 scaffold_83, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 607 Score = 31.5 bits (68), Expect(2) = 3.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP ++ Sbjct: 113 PPPPPPPPPPPPPAQS 128 Score = 21.8 bits (44), Expect(2) = 3.5 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPP 822 P P ++ PPPPPP Sbjct: 75 PIPPSPPPQQPSPPPPPPP 93 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 653,084,945 Number of Sequences: 1657284 Number of extensions: 14490031 Number of successful extensions: 187182 Number of sequences better than 10.0: 477 Number of HSP's better than 10.0 without gapping: 32397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105462 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 76243001646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -