BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E01 (861 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 39 0.006 07_01_0080 + 587674-588510 38 0.008 04_01_0034 - 401208-402923 38 0.008 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 38 0.010 02_05_0686 - 30900748-30902167,30903442-30904742 38 0.014 06_03_1153 - 28047125-28047751 37 0.024 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 36 0.055 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 36 0.055 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 35 0.096 03_02_0738 - 10824121-10825572 35 0.096 03_01_0515 - 3864796-3865425 35 0.096 08_01_0493 - 4297761-4298288 28 0.12 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 34 0.13 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 34 0.13 12_02_1174 - 26696869-26698191 34 0.17 08_01_0059 - 394001-394708 34 0.17 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 34 0.17 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 33 0.22 04_01_0197 + 2323790-2324098,2324145-2324774 33 0.22 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 33 0.29 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 33 0.29 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 33 0.29 03_05_0587 - 25878948-25879201,25879290-25879361,25881091-25881451 33 0.29 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 33 0.29 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 33 0.29 07_03_0890 - 22332768-22333382 33 0.39 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 33 0.39 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 33 0.39 05_04_0011 + 17139322-17139451,17139552-17140174 25 0.46 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 32 0.51 08_02_0193 - 14073103-14073246,14073332-14073481,14073571-140736... 32 0.51 07_03_1382 - 26170563-26170631,26171151-26171843 32 0.51 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 32 0.51 05_01_0142 - 940421-940701,941262-941574 32 0.51 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 32 0.51 01_05_0490 + 22672241-22674679 32 0.51 12_02_0299 - 17051570-17052474,17053542-17053755 32 0.68 09_03_0145 - 12749288-12751510 32 0.68 09_02_0327 - 7284829-7284889,7284946-7286126 32 0.68 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 32 0.68 07_03_1636 + 28290642-28291574 32 0.68 05_01_0380 + 2978256-2979284 32 0.68 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 32 0.68 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 32 0.68 02_01_0016 + 110796-110979,111252-111768,111847-112213 25 0.71 04_04_0500 - 25677767-25680850 25 0.85 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 31 0.89 11_06_0610 - 25449085-25453284 31 0.89 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 31 0.89 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 31 0.89 08_02_1329 - 26182762-26183007,26183149-26183249,26183533-261836... 31 0.89 08_02_0796 - 21300251-21300373,21300846-21301721 31 0.89 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 31 0.89 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 31 0.89 07_03_0154 + 14509979-14512033 31 0.89 06_03_1363 - 29576265-29577575 31 0.89 05_01_0137 + 917533-917814,918080-918352 31 0.89 04_04_1630 - 34896021-34896143,34896329-34896403,34896500-348965... 31 0.89 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 31 0.89 02_04_0520 - 23628183-23628195,23629354-23630036 31 0.89 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 31 0.89 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 31 1.2 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 31 1.2 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 31 1.2 08_02_1256 + 25645085-25645396 31 1.2 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 31 1.2 07_03_0600 + 19866757-19867218,19867920-19868429 31 1.2 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 31 1.2 04_04_1687 - 35365766-35366356,35367137-35368135 31 1.2 02_03_0279 + 17250347-17252098 31 1.2 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 31 1.2 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 31 1.2 09_02_0569 - 10752756-10753164,10753229-10753644,10754149-107553... 26 1.4 11_06_0016 - 19284810-19284926,19285527-19286879 29 1.5 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 31 1.6 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 31 1.6 08_02_0937 + 22801526-22802461 31 1.6 06_03_0696 + 23617687-23617851,23618838-23619536 31 1.6 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 31 1.6 03_06_0599 + 34984869-34985319,34986581-34987563 31 1.6 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 1.6 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.6 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 31 1.6 01_01_0082 + 625198-625719 31 1.6 11_01_0359 - 2731522-2732346 30 2.1 09_04_0365 - 16962608-16963174,16963301-16963486,16963824-169638... 30 2.1 08_02_1615 + 28257275-28258428,28258523-28259144 30 2.1 08_02_1084 - 24232968-24234779 30 2.1 07_03_1771 - 29404972-29405175,29405282-29405677 30 2.1 07_01_0516 - 3850252-3852870 30 2.1 05_01_0210 + 1583176-1584177 30 2.1 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 30 2.1 03_05_0161 + 21400580-21401695 30 2.1 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 30 2.1 01_06_0969 - 33472588-33474480,33475543-33475623,33475692-334757... 30 2.1 01_01_0046 - 331758-332627 30 2.1 02_05_1249 - 35240823-35242184 27 2.6 07_01_0015 + 108338-109186 25 2.7 12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561,976... 30 2.7 11_01_0066 - 536281-537196,537397-537452 30 2.7 10_03_0035 - 7265037-7265455,7265684-7265812,7265909-7265951,726... 30 2.7 07_01_0479 + 3606663-3607448 30 2.7 07_01_0439 + 3333654-3334217 30 2.7 03_02_0342 - 7645323-7645909,7646323-7646491 30 2.7 02_05_0201 + 26687369-26689228 30 2.7 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 30 2.7 09_04_0192 + 15478270-15480257,15480358-15480640,15480727-15481116 25 3.2 12_02_0848 + 23636478-23638058 29 3.6 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 29 3.6 11_01_0621 - 4981070-4981136,4982906-4983825 29 3.6 08_02_1143 + 24659105-24659386,24660171-24660272,24661259-246615... 29 3.6 07_01_0662 + 4972953-4973645,4973758-4974046,4974790-4974803,497... 29 3.6 07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922,291... 29 3.6 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 29 3.6 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 3.6 05_07_0031 - 27183252-27183317,27183542-27184282 29 3.6 05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149,275... 29 3.6 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 3.6 04_04_1216 + 31811403-31812267,31813187-31813877,31813981-318141... 29 3.6 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 29 3.6 04_01_0354 - 4646826-4647314 29 3.6 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 29 3.6 02_03_0132 - 15584673-15584789,15584957-15585054,15585151-15585550 29 3.6 02_01_0674 + 5020118-5020202,5020301-5020436,5021075-5021140,502... 29 3.6 03_06_0600 + 34988743-34989407,34990033-34990051 24 4.6 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 29 4.8 08_02_0703 - 20188489-20190246 29 4.8 07_03_1788 + 29523216-29524867,29525048-29525075 29 4.8 07_03_1381 - 26166673-26166747,26166972-26167544 29 4.8 07_01_0753 - 5799733-5799741,5799938-5800642 29 4.8 05_06_0063 + 25289117-25290643 29 4.8 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 4.8 03_05_0843 + 28126480-28127007,28127092-28127457,28129388-281294... 29 4.8 03_05_0067 - 20460206-20460703,20461255-20461530 29 4.8 03_04_0042 - 16743440-16743454,16743907-16744002,16744257-167444... 29 4.8 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 29 4.8 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 29 4.8 01_06_1402 + 37052996-37053449,37053533-37053630,37053718-370538... 29 4.8 01_06_1330 - 36361275-36361448,36361778-36361973,36362248-363623... 29 4.8 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 25 5.3 11_01_0021 - 143576-143932,144434-144667,144988-145066,145138-14... 24 5.4 01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567,925... 25 5.5 08_02_0839 + 21693348-21694853 25 5.6 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 28 5.7 12_02_1070 - 25814741-25815850 29 6.3 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 29 6.3 12_01_0742 - 6656464-6656739 29 6.3 11_01_0429 - 3288081-3288781,3290038-3290293 29 6.3 10_08_0638 - 19503580-19503990 29 6.3 10_08_0543 - 18649894-18650233,18651446-18651981 29 6.3 10_08_0520 - 18495118-18498237 29 6.3 10_07_0053 - 12406958-12407011,12407012-12407168,12407280-124074... 29 6.3 10_04_0005 + 7390697-7390705,7390943-7391096,7391225-7391424,739... 29 6.3 10_02_0009 + 4128909-4130123 29 6.3 09_04_0506 - 18188785-18190599 29 6.3 06_03_0447 + 20878444-20878821 29 6.3 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 29 6.3 04_03_1022 - 21778315-21779007 29 6.3 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 29 6.3 04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064,654... 29 6.3 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 29 6.3 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 29 6.3 02_04_0021 + 18975992-18976408 29 6.3 02_04_0001 - 18816492-18816741,18816881-18817050,18817244-188173... 29 6.3 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 6.3 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 29 6.3 01_01_0796 + 6190931-6192745 29 6.3 01_01_0070 - 542603-542686,542803-543441 29 6.3 12_02_1119 + 26213719-26213955,26214039-26214197,26214640-262147... 28 8.3 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 28 8.3 12_01_0495 - 3935395-3937110 28 8.3 10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 28 8.3 10_03_0023 - 7151465-7152111,7152222-7152405 28 8.3 09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155... 28 8.3 09_02_0543 + 10427321-10428315,10428440-10429154 28 8.3 08_02_1334 - 26224546-26225337 28 8.3 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 28 8.3 08_01_0060 - 413088-413999 28 8.3 07_03_1090 + 23891294-23892222,23892317-23892516,23895241-238954... 28 8.3 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 28 8.3 07_01_0862 - 7172083-7172931 28 8.3 06_03_1368 - 29612463-29612638,29613135-29613222,29613334-296134... 28 8.3 06_03_1006 + 26844161-26844198,26844304-26844372,26844526-268445... 28 8.3 05_04_0156 - 18598926-18599177 28 8.3 05_02_0099 - 6582498-6582725,6583148-6583235,6583437-6583830,658... 28 8.3 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 28 8.3 04_04_0675 + 27183826-27184443 28 8.3 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 28 8.3 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 28 8.3 03_05_0865 - 28365430-28367640 28 8.3 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 28 8.3 03_05_0019 + 19862171-19863049 28 8.3 03_04_0191 - 18293842-18294273 28 8.3 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 28 8.3 02_04_0382 - 22501041-22501279,22501717-22501810 28 8.3 01_06_1377 + 36764461-36765339 28 8.3 01_06_1321 + 36280691-36281269 28 8.3 01_05_0535 - 23001864-23005052 28 8.3 01_01_1101 + 8731427-8732938 28 8.3 11_05_0093 + 18992027-18993514 25 9.3 09_01_0037 - 604001-604957 24 9.7 03_03_0262 + 15968884-15969687 24 9.9 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPPP PPP++ Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQPPPRE 135 Score = 37.5 bits (83), Expect = 0.014 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + PPPPPPP PP Sbjct: 93 PPPPPPYGVNSSQPPPPPPPPPSPPP 118 Score = 36.7 bits (81), Expect = 0.024 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPP 118 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P P Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPPSAPP 122 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 Query: 737 KIYXXGRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 ++Y PPPP + PPPPP P P P Sbjct: 87 QMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPP 125 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G PPP PPPPPPP PP Sbjct: 39 GHMPPPQG-APPPFLAPPPPPPPGPPPP 65 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP--XPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 94 PPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPP 126 >07_01_0080 + 587674-588510 Length = 278 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPP 117 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 94 PPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 37.5 bits (83), Expect = 0.014 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 37.5 bits (83), Expect = 0.014 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 35.9 bits (79), Expect = 0.042 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 R PPPPP PPPPP P P P Sbjct: 89 RRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 >04_01_0034 - 401208-402923 Length = 571 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + K PPPPPPP PP Sbjct: 308 PPPPPQQQRAKPSRPPPPPPPLDPPP 333 Score = 36.7 bits (81), Expect = 0.024 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP ++ PPPPPP PPP+ Sbjct: 307 PPPPPPQQQRAKPSRPPPPPPPLDPPPR 334 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP K PPPPPPP PP Sbjct: 549 PPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP KK PPPPPP PP Sbjct: 750 PPPPPLMTGKKAPAPPPPPPQAPKPP 775 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPP PPP Sbjct: 548 PPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP K PPPPPPP P P+ Sbjct: 550 PPPPPSGNKPAFSPPPPPPPPPPPPLPQ 577 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP----XXXPPP 843 PPPP + PPPPPPP PPP Sbjct: 606 PPPPPILPNRSVPPPPPPPPPLPNHSVLPPP 636 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 PPPPP + PPPPP P P + Sbjct: 620 PPPPPPPLPNHSVLPPPPPPPPPPSLPNR 648 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP N PPPPP P Sbjct: 603 PPPPPPPPILPNRSVPPPPPPP 624 Score = 33.1 bits (72), Expect = 0.29 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP ++ PPPPP P Sbjct: 605 PPPPPPILPNRSVPPPPPPPPP 626 Score = 32.7 bits (71), Expect = 0.39 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 620 PPPPPPPLPNHSVLPPPPPPP---PPP 643 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPPP K PPPPPPP Sbjct: 651 PPPPAPGIGNKFPAPPPPPPP 671 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP KK PPPPP Sbjct: 750 PPPPPLMTGKKAPAPPPPPP 769 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP 837 PPPP PPPPPPP P Sbjct: 571 PPPPLPQSNYASSQPPPPPPPPPLP 595 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP + PPPPP P Sbjct: 619 PPPPPPPPLPNHSVLPPPPPPP 640 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP 837 PPPP PPPPPPP P Sbjct: 604 PPPPPPPILPNRSVPPPPPPPPPLP 628 Score = 31.5 bits (68), Expect = 0.89 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP PPPPP P Sbjct: 604 PPPPPPPILPNRSVPPPPPPPP 625 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP P Sbjct: 588 PPPPPPLPNCLVPSPPPPPPPPPILP 613 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP PPPPP P P Sbjct: 550 PPPPPSGNKPAFSPPPPPPPPPPPPLP 576 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPP P K+N PPPPP Sbjct: 735 PPPLPAAANKRNPPAPPPPP 754 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP PPPPP P Sbjct: 570 PPPPPLPQSNYASSQPPPPPPP 591 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPP K PPPPPPP Sbjct: 652 PPPAPGIGNKFPAPPPPPPPP 672 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP K PPPPP Sbjct: 764 PPPPPPQAPKPPGTVPPPPP 783 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPP P P Sbjct: 569 PPPPPPLPQSNYASSQPPPPPPPPPLP 595 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP N P PPP P Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPP 606 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 PPPPP PPPPP P P + Sbjct: 587 PPPPPPPLPNCLVPSPPPPPPPPPILPNR 615 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +3 Query: 717 PPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPPXXXXAXPXKN 851 PP Y PPPP + PPPPP P ++ Sbjct: 572 PPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRS 616 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP N PPPP P Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPP 639 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPP P G P Sbjct: 635 PPPPPPPPPSLPNRLVPPPPAPGIGNKFPAP 665 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 6/44 (13%) Frame = +1 Query: 739 NIFXGAGXPPPPXXFXKKKXXXP------PPPPPPXXXPPPKKT 852 N F PPPP + PPPPPP PP +T Sbjct: 660 NKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRT 703 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPP-P---PPPPXXXPPP 843 PPPP KK PP P P PP PPP Sbjct: 751 PPPPLMTGKKAPAPPPPPPQAPKPPGTVPPP 781 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP PPPP P P Sbjct: 569 PPPPPPLPQSNYASSQPPPPPPPPPLP 595 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 587 PPPPPPPLPNCLVPSPPPPPP---PPP 610 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP + N P PP P Sbjct: 714 PPPPPPPANRSNGPSAPAPPLP 735 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPP K PPPPPPP PPP Sbjct: 309 ASPAPPPPPPPKPAAAAPPPPPPPKAAPPP 338 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 329 PPPPKAAPPPPPPKGPPPPPPAKGPPP 355 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPP 339 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGG 617 PP G P P G P P K PPP P GG Sbjct: 348 PPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGG 385 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP PP P PP G P P K PPP P PP Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPP 366 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 P PPP K PPPPP P P P Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPP 341 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPP PPP K Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPK 342 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP KK PPPPP P P Sbjct: 361 GPSPPPPPPPGGKKG-GPPPPPPKGGASRPPAAP 393 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPP P G P P Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 Score = 31.5 bits (68), Expect = 0.89 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGG 617 PP G P PP G P P K PPP P GG Sbjct: 339 PPPKGPP----PPPPAKGPPPPPPPKGPSPPPPPPPGG 372 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPPP PP Sbjct: 343 GPPPPPPA------KGPPPPPPPKGPSPP 365 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPP P P Sbjct: 335 APPPPPPKGPPPPPPAKGPPPPPPPKGPSP 364 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 + PPPPP K PPPPP G P P Sbjct: 351 KGPPPPPPP--KGPSPPPPPPPGGKKGGPPPPP 381 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 A PPPP K PPPP P PP K Sbjct: 323 AAAPPPPPP--PKAAPPPPPPKGPPPPPPAK 351 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP PPPPP P P P Sbjct: 338 PPPPKGPPPPPPAKGPPPPPPPKGPSPPPPP 368 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPP----PPPXPXXGXPXKKP 853 PPPPP PP PPP P G P P Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPP P P K P Sbjct: 326 PPPPPPP---KAAPPPPPPKGPPPPPPAKGP 353 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPP P G P Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP 367 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP--PXXXPPP 843 G PPPP K PPPPPP PPP Sbjct: 352 GPPPPPPP---KGPSPPPPPPPGGKKGGPPP 379 >06_03_1153 - 28047125-28047751 Length = 208 Score = 36.7 bits (81), Expect = 0.024 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 +G PPPP F PPPPPP PP Sbjct: 6 SGAPPPPAIFCPPPLSPPPPPPPIFYSPP 34 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 35.5 bits (78), Expect = 0.055 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP-PXXXPPPKK 849 G G PPP K PPPPPP PPP K Sbjct: 135 GPGQEPPPPHVPKAAPPPPPPPPPHAPPGPPPTK 168 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 225 PPPPSPHRHPAAHPPPPPHHPAPRPPP 251 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPP--PPXXXPPP 843 PPPP + PPPPP P PPP Sbjct: 224 PPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP + PPPPP Sbjct: 223 PPPPPPSPHRHPAAHPPPPP 242 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP PPP P P P Sbjct: 218 GAPPPPPPPPPSPHRHPAAHPPPPPHHPAPRPPP 251 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 35.5 bits (78), Expect = 0.055 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAP 64 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PP Sbjct: 39 PPPARHRAPSPPRPPPPPPPPTQPAPP 65 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP PPPPP P P P Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPPP 68 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 34.7 bits (76), Expect = 0.096 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F PPPPPPP P Sbjct: 335 PPPPSRFNNTTPKPPPPPPPPEPPTGP 361 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + N P PPP P P P Sbjct: 331 PPPPPPPPSRFNNTTPKPPPPPPPPEPPTGP 361 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP PPPPPP PP Sbjct: 330 APPPPPPPPSRFNNTTPKPPPPPPPPEPP 358 >03_02_0738 - 10824121-10825572 Length = 483 Score = 34.7 bits (76), Expect = 0.096 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPPP PPP Sbjct: 80 PPSPPSSSPPPLSFPPPPPPPSSPPPP 106 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPP PPP Sbjct: 79 PPPSPPSSSPPPLSFPPPPPPPSSPPP 105 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPP P PPPPP P P P Sbjct: 79 PPPSPPSSSPPPLSFPPPPPPPSSPPPPALP 109 >03_01_0515 - 3864796-3865425 Length = 209 Score = 34.7 bits (76), Expect = 0.096 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PPP Sbjct: 75 PPPSVTSSPPPPPLPPPPPPPAASPPP 101 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXP-PPPPPPXXXPPP 843 PPPP P PPPPPP PP Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPPAASPP 100 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPP PP Sbjct: 84 PPPPLPPPPPPPAASPPPPPPSPPPP 109 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 92 PPPPAASPPPPPPSPPPPSPVKSSPPP 118 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP PPP Sbjct: 83 PPPPPLPPPPPPPAASPPPPPPSPPPP 109 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP PPPPP P P P Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPP P P P Sbjct: 90 PPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPP P P P Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPPAASPPPPP 103 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 PPP P PPPPP P P K Sbjct: 85 PPPLPPPPPPPAASPPPPPPSPPPPSPVK 113 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP P PP P PPP P PP Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPP 102 >08_01_0493 - 4297761-4298288 Length = 175 Score = 27.9 bits (59), Expect(2) = 0.12 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 P PP PPPPPPP Sbjct: 103 PSPPQHALSPAVPPPPPPPPP 123 Score = 25.4 bits (53), Expect(2) = 0.12 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 115 PPPPPPPPPSP 125 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPP P PPP K Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIK 381 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPP PP PP KK Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIKK 382 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 793 KXXXPPPPPPPXXXPPP 843 K PPPPPPP PPP Sbjct: 350 KLMPPPPPPPPPPPPPP 366 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP G P P Sbjct: 359 PPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 360 PPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP KK P PPPPP Sbjct: 152 GPPPPPDHVLKKVPSHPSPPPPP 174 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 734 KKIYXXGRXPPPPPXXXXKKNXXXPPPPPXP 826 KK + PPPPP PPPPP P Sbjct: 103 KKRHHHHHPPPPPPPHLLHYYGHPPPPPPPP 133 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +2 Query: 761 PPPPPXXXXKK--NXXXPPPPPXP 826 PPPPP KK + PPPPP P Sbjct: 153 PPPPPDHVLKKVPSHPSPPPPPAP 176 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPP PPP K Sbjct: 112 PPPPPPHLLHYYGHPPPPPP---PPPPFK 137 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP PPPPP P Sbjct: 113 PPPPPHLLHYYGHPPPPPPPPP 134 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 726 GGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPP 821 GG + G PPPP KK PPPP Sbjct: 142 GGVYQNWQQNGPPPPPDHVLKKVPSHPSPPPP 173 >12_02_1174 - 26696869-26698191 Length = 440 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 763 PP--PPXXFXKKKXXXPPPPPPPXXXPPPK 846 PP PP + PPPPPPP PPP+ Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPPPPPPPR 166 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP P P Sbjct: 141 PPPVKPQPPPSLPPPPPPPPPPPPPRP 167 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPP-----PPPXXXPPPKK 849 PPPP + PP P PPP PPP++ Sbjct: 274 PPPPEDYWSPTAVTPPEPTKPKPPPPSPPPPPQQ 307 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 R PP P PPPPP P P KP Sbjct: 140 RPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKP 172 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + + P PPP PPP Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPP 150 >08_01_0059 - 394001-394708 Length = 235 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 11 PPPPATPPPPPRRAPPPPSPPIRPPPP 37 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP PPP Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPP 28 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPP PPPP P PPP T Sbjct: 11 PPPPATPPPPPRRAPPPPSPPIRPPPPPT 39 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 808 PPPPPPXXXPPPKKT 852 PPPPPP PPP T Sbjct: 2 PPPPPPRRAPPPPAT 16 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP---XPXXGXPXKKP 853 PPPPP PPPPP P P + P Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPP 35 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP + + PPPPPP PPP Sbjct: 13 PSPPPFSSRPRVVGPPPPPPSDPPPPP 39 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPPP PPP Sbjct: 15 PPPFSSRPRVVGPPPPPPSDPPPPPP 40 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 33.5 bits (73), Expect = 0.22 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 7/78 (8%) Frame = -3 Query: 820 GGGGGXXXIFFXXXXXGGGGXPPXXIYFFXPPXGGX--PXQKKPPGXFXGXXPXPXXK-X 650 GG GG G GG PP PP GG P PP F G P P Sbjct: 1128 GGLGGHQAPPAPPLPEGIGGVPPP------PPVGGLGGPPAPPPPAGFRGGTPPPNAHGG 1181 Query: 649 XXPPPXPXXG----GXPP 608 PPP P G G PP Sbjct: 1182 VAPPPPPPRGHGGVGGPP 1199 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 678 PKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPPXXXXAXP 842 P PGG PP G GG PP + I PPPPP P Sbjct: 1111 PPPPPGGITGVPPPPPIGG-----LGGHQAPPAPPLPEGIGGVPPPPPVGGLGGP 1160 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 736 KNIFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +N G G P + PPPPPPP PPP Sbjct: 6 RNANTGDGNQPEGSNHNHQGNPPPPPPPPPPPPPPP 41 Score = 32.3 bits (70), Expect = 0.51 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 28 PPPPPPPPPPPPPPDT 43 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 GA PPPP K PPPPPPP P Sbjct: 927 GAPPPPPPPG---KPGGPPPPPPPPGSLP 952 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPP--PXXXPPP 843 PPPP + PPPPPP P PPP Sbjct: 920 PPPP----RPPGAPPPPPPPGKPGGPPPP 944 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPP P PPP Sbjct: 905 PPAPSATANTASALSPPPPRPPGAPPP 931 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P PPPP PP PPP Sbjct: 906 PAPSATANTASALSPPPPRPPGAPPPP 932 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 A PPP PPPPPPP P P T Sbjct: 71 AAPPPPQTPPSPPPPPPPPPPPPPPLSPTPTTT 103 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP P PPP Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPP 451 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPP P P P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPP 455 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP PPPP G P Sbjct: 438 PPPPPPLPPNMPPPLPPPPEPELNGAP 464 >03_05_0587 - 25878948-25879201,25879290-25879361,25881091-25881451 Length = 228 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPPKK 849 PPPP F +K PPPPP PPP++ Sbjct: 132 PPPPVAFRRKPPAREAPPPPPAAEKLSPPPQQ 163 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 P P PPPPPPP PPP K Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPPK 366 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP PPPPP P P Sbjct: 358 PPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 32.3 bits (70), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K N PPPP P Sbjct: 357 PPPPPPPPPKLNTAPKPPPPPP 378 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP K P PPPP PP Sbjct: 356 PPPPPPPPPPKLNTAPKPPPPPPPPP 381 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPP---PPXXXPPPKKT 852 PPPP + PPPPP PP PPP T Sbjct: 431 PPPPEHPPPPESTSPPPPPTSDPPPVPPPPPTT 463 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPP---PPPPXXXPPPKKT 852 PPPP + PPP PPP PPP T Sbjct: 418 PPPPLPSDAFEQPPPPPEHPPPPESTSPPPPPT 450 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPP PP Sbjct: 430 PPPPPEHPPPPESTSPPPPPTSDPPP 455 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP PPPPP Sbjct: 430 PPPPPEHPPPPESTSPPPPP 449 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPP PPP Sbjct: 430 PPPPPEHPPPPESTSPPPPPTSDPPP 455 >07_03_0890 - 22332768-22333382 Length = 204 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + PPPPPPP P Sbjct: 90 PPPPERAVPEAADTPPPPPPPTAPTP 115 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPP P P Sbjct: 89 PPPPPERAVPEAADTPPPPPPPTAPTP 115 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPPPP P P Sbjct: 91 PPPERAVPEAADTPPPPPPPTAPTPTP 117 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP ++ PPPPPP PP Sbjct: 74 PPPPAPRPPRRHHRIPPPPPPLLPTPP 100 Score = 32.3 bits (70), Expect = 0.51 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP ++ PPPPPP PPP Sbjct: 75 PPPAPRPPRRHHRIPPPPPPLLPTPPP 101 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPP PP PPPP PPP T Sbjct: 99 PPPPPASISPTPAPPLPPPPAPAPPPTPT 127 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPP P PPPPP PP++ Sbjct: 57 PPPPPLPTPTVTTPTPPPPPPAPRPPRR 84 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPP PP Sbjct: 57 PPPPPLPTPTVTTPTPPPPPPAPRPP 82 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPP P P P Sbjct: 73 PPPPPAPRPPRRHHRIPPPPPPLLPTPPPPP 103 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP PPPPP Sbjct: 57 PPPPPLPTPTVTTPTPPPPP 76 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP P PPPP PP Sbjct: 99 PPPPPASISPTPAPPLPPPPAPAPPP 124 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P P P Sbjct: 100 PPPPASISPTPAPPLPPPPAPAPPPTP 126 >04_04_0760 - 27837170-27837328,27837441-27837504,27837812-27838160, 27838906-27838960,27839489-27839821 Length = 319 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPP PKK Sbjct: 13 PPPPSESTPTSDPKPPPPPPTSSTAAPKK 41 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKK 850 PPPP + PPPPP P K+ Sbjct: 13 PPPPSESTPTSDPKPPPPPPTSSTAAPKKR 42 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 25.4 bits (53), Expect(3) = 0.46 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 67 PPPPPPPPSPP 77 Score = 22.2 bits (45), Expect(3) = 0.46 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 811 PPPPPXXXPPP 843 PPPPP PP Sbjct: 103 PPPPPPPPSPP 113 Score = 21.8 bits (44), Expect(3) = 0.46 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPP 822 P P + PPPPPP Sbjct: 55 PTGPNPVHNEFQPPPPPPPP 74 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 32.3 bits (70), Expect = 0.51 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP K + PPPPP PPP Sbjct: 98 PPPTPLLPKHQQAPPPPPPTQSHQPPP 124 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPP--PXXXPPP 843 PPP K PPPPPP PPP Sbjct: 98 PPPTPLLPKHQQAPPPPPPTQSHQPPPP 125 >08_02_0193 - 14073103-14073246,14073332-14073481,14073571-14073640, 14073900-14074021,14074260-14074395,14074492-14074967 Length = 365 Score = 32.3 bits (70), Expect = 0.51 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPP 825 PPP +++ PPPPPPP Sbjct: 52 PPPPPLCRRRRSWPPPPPPP 71 Score = 31.5 bits (68), Expect = 0.89 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP +++ PPPPP Sbjct: 52 PPPPPLCRRRRSWPPPPPPP 71 Score = 31.5 bits (68), Expect = 0.89 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPP 822 PPPP +++ PPPPPP Sbjct: 52 PPPPPLCRRRRSWPPPPPPP 71 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 32.3 bits (70), Expect = 0.51 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPP 820 G PPPPP N PPPPP Sbjct: 183 GPPPPPPPQPSGDANENPPPPPP 205 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 32.3 bits (70), Expect = 0.51 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PP P PPPPPP PPP++ Sbjct: 236 PPKPANIAGAPGLPLPPPPPPPPGPPPRE 264 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPPPP P P Sbjct: 260 PPPREIVPGQTLLPPPPPPRPLQPSP 285 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 383 PPPPPPPDTRPP 394 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPP----PPPPXXXPP 840 G PPPP + PPP PPPP PP Sbjct: 39 GYPPPPGAYPPPPGAYPPPPGAYPPPPGAYPP 70 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 32.3 bits (70), Expect = 0.51 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P F + P PPPP PPP Sbjct: 73 PPRPPSFAPENALPPSSPPPPSPPPPP 99 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PP PPP PPP Sbjct: 72 PPPRPPSFAPENALPPSSPPPPSPPPP 98 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXP--PPPPXPXXGXPXKKP 853 PPP P +N P PPPP P P P Sbjct: 72 PPPRPPSFAPENALPPSSPPPPSPPPPPPSSPP 104 >01_05_0490 + 22672241-22674679 Length = 812 Score = 32.3 bits (70), Expect = 0.51 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP +K PP P P PPP++ Sbjct: 644 PPPPTTRRSRKPPQPPSRPAPPPPPPPQQ 672 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP ++ P PP P PPP Sbjct: 642 PPPPPPTTRRSRKPPQPPSRPAPPPPP 668 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP ++ PP PP PPP Sbjct: 641 PPPPPPPTTRRSRKPPQPPSRPAPPPP 667 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP +++ P PP P P Sbjct: 641 PPPPPPPTTRRSRKPPQPPSRPAPPPP 667 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P + PPPPPPP P P Sbjct: 311 PPLPSFYPSPPPPPPPPPPPPPSFPWP 337 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP F P PPPPP PPP Sbjct: 305 PPLPHFPPLPSFYPSPPPPPPPPPPP 330 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPP PPP Sbjct: 305 PPLPHFPPLPSFYPSPPPPPPPPPPPP 331 >09_03_0145 - 12749288-12751510 Length = 740 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPPP 843 PP PPPPPPP PPP Sbjct: 19 PPFKPKPTNPSPPPPPPPPGIQPPP 43 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 31.9 bits (69), Expect = 0.68 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPP+ Sbjct: 55 PPPPPPPPPPPPPR 68 Score = 31.5 bits (68), Expect = 0.89 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PPP + Sbjct: 54 PPPPPPPPPPPPPPR 68 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPP 65 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP PPPPPP PPP+ Sbjct: 1169 PPPPPPL-SPSLPPPPPPPPLPSGPPPQ 1195 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P +P Sbjct: 1169 PPPPPPLSPS---LPPPPPPPPLPSGPPPQP 1196 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PP P + PP PPP PPP Sbjct: 1145 GPPPLPSDSPPCQPPLPPSPPPATPPPPP 1173 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP P PPP P P P Sbjct: 1181 PPPPPPPLPSGPPPQPAPPPLPIQPPPIPPP 1211 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPP--PPXXXPPP 843 PPPP PPP P PP PPP Sbjct: 1184 PPPPLPSGPPPQPAPPPLPIQPPPIPPPP 1212 >07_03_1636 + 28290642-28291574 Length = 310 Score = 31.9 bits (69), Expect = 0.68 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP + +K P PPP PPP +T Sbjct: 170 PPPPDAYLRKPSP-PSPPPAKLSPPPPPQT 198 >05_01_0380 + 2978256-2979284 Length = 342 Score = 31.9 bits (69), Expect = 0.68 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPP+ Sbjct: 29 PPPPPPPPPPPPPR 42 Score = 31.5 bits (68), Expect = 0.89 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PPP + Sbjct: 28 PPPPPPPPPPPPPPR 42 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPP 38 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPP 39 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 366 PPPPPPPPPPPPPAVT 381 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 365 PPPPPPPPPPPPP 377 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = +1 Query: 763 PPPPXXFXK---KKXXXP--PPPPPPXXXPPP 843 PPPP + K P PPPPPP PPP Sbjct: 375 PPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPP 406 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 7/34 (20%) Frame = +1 Query: 763 PPPPXXFXKKKXXX-------PPPPPPPXXXPPP 843 PPPP +++ PPPPPP PPP Sbjct: 374 PPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPP 843 P F PPPPPPP PPP Sbjct: 32 PFTFLCPPPPPPPPPPPPPPPPPP 55 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 38 PPPPPP--------PPPPPPPPPPPPP 56 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 25.4 bits (53), Expect(2) = 0.71 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 216 PPPPPPPPPQP 226 Score = 25.0 bits (52), Expect(2) = 0.71 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPP 825 P P PPPPPPP Sbjct: 205 PTPPSLPVDTMPPPPPPPPP 224 >04_04_0500 - 25677767-25680850 Length = 1027 Score = 25.0 bits (52), Expect(2) = 0.85 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 787 KKKXXXPPPPPPP 825 K + PPPPPPP Sbjct: 12 KPRANQPPPPPPP 24 Score = 25.0 bits (52), Expect(2) = 0.85 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP P Sbjct: 19 PPPPPPPFRLAP 30 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPP P PPP Sbjct: 600 PPAPSATANTASALPPPPPRPPGAPPP 626 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPP P PPPPP P P P Sbjct: 599 PPPAPSATANTASALPPPPPRPPGAPPPPPP 629 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPP--PXXXPPP 843 PPPP + PPPPPP P PPP Sbjct: 614 PPPPP---RPPGAPPPPPPPGKPGGPPPP 639 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G PPPP K PPPPP P P Sbjct: 622 GAPPPPPP-PGKPGGPPPPPPRPGSLP 647 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP G P P Sbjct: 614 PPPPPRPP---GAPPPPPPPGKPGGPPPPPP 641 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P PPPP P PPP+K+ Sbjct: 1218 PPAPVILPPPPVKSPPPPAPVISPPPPEKS 1247 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P PPPP P PPP K+ Sbjct: 1154 PPAPVILPPPPIKSPPPPAPVISPPPPVKS 1183 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P PPPP P PPP K+ Sbjct: 1186 PPAPVILPPPPVKSPPPPAPVISPPPPVKS 1215 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P PPPP P PPP K+ Sbjct: 1170 PPAPVISPPPPVKSPPPPAPVILPPPPVKS 1199 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P PPPP P PPP K+ Sbjct: 1202 PPAPVISPPPPVKSPPPPAPVILPPPPVKS 1231 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPP P PPP Sbjct: 1153 PPPAPVILPPPPIKSPPPPAPVISPPP 1179 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPP P PPP Sbjct: 1169 PPPAPVISPPPPVKSPPPPAPVILPPP 1195 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPP P PPP Sbjct: 1185 PPPAPVILPPPPVKSPPPPAPVISPPP 1211 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPP P PPP Sbjct: 1201 PPPAPVISPPPPVKSPPPPAPVILPPP 1227 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPP P PPP Sbjct: 1217 PPPAPVILPPPPVKSPPPPAPVISPPP 1243 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P PPPP P PPP K+ Sbjct: 1138 PPVPVSSPPPPEKSPPPPAPVILPPPPIKS 1167 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPP-PPXXXPPP 843 P PP + PPPPP PP PPP Sbjct: 31 PVPPDPYGADLSPPPPPPPKPPPTVPPP 58 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 P PP + PPPPPPP PP Sbjct: 41 PAPPSTPQLRGEASPPPPPPPPVGPP 66 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 26 PPPPPPHPPPPP 37 >08_02_1329 - 26182762-26183007,26183149-26183249,26183533-26183602, 26183692-26183895,26186435-26186941,26188672-26188677 Length = 377 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 755 RXPPPPPXXXXK-KNXXXPPPPPXPXXG 835 R PPPPP + + PPPPP P G Sbjct: 67 RAPPPPPSHHERAPSDAPPPPPPAPYAG 94 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 31.5 bits (68), Expect = 0.89 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPP+ Sbjct: 104 PPPPPPPPPPPPPQ 117 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 103 PPPPPPPPPPPPP 115 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP 837 PP P PPPPPPP P Sbjct: 94 PPSPPLLALPPPPPPPPPPPPPPQP 118 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP P P++ Sbjct: 106 PPPPPPPPPPPQPQQ 120 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXX---PPPXPXXGGXPP 608 GGGG PP P PP G P P + PPP P G PP Sbjct: 14 GGGGAPPQWGAIPPPVPHQQQQYAPPPPQMWGQAPPPPPQMWGQAPPPPQPAYGQPPP 71 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP + + PPPP P PPP Sbjct: 45 GQAPPPPPQMWGQA----PPPPQPAYGQPPP 71 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PP P PPPPPPP PP Sbjct: 46 APPPPQPTLPPPPPRTLPPPPPPPPPQPP 74 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPP PP Sbjct: 48 PPPQPTLPPPPPRTLPPPPPPPPPQPP 74 >07_03_0154 + 14509979-14512033 Length = 684 Score = 31.5 bits (68), Expect = 0.89 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPP+ Sbjct: 54 PPPPPPPPPPPPPQ 67 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPP 65 >06_03_1363 - 29576265-29577575 Length = 436 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 726 GGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPP 821 GG K I PPPP +++ PPPPP Sbjct: 379 GGGKVLIVDVTPPPPPPPAARRESWAAPPPPP 410 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +3 Query: 720 PXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPPPXXXXAXP 842 P GG + PPPP ++ PPPP A P Sbjct: 378 PGGGKVLIVDVTPPPPPPPAARRESWAAPPPPPRMWEVAAP 418 >05_01_0137 + 917533-917814,918080-918352 Length = 184 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 3/24 (12%) Frame = +1 Query: 763 PPPPXXFXKK---KXXXPPPPPPP 825 PPPP F ++ + PPPPPPP Sbjct: 69 PPPPPSFRRRSFCRRCTPPPPPPP 92 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 761 PPPPPXXXXKK--NXXXPPPPPXPXXG 835 PPPPP + PPPPP P G Sbjct: 69 PPPPPSFRRRSFCRRCTPPPPPPPAAG 95 >04_04_1630 - 34896021-34896143,34896329-34896403,34896500-34896556, 34897176-34897352,34897426-34897492,34898043-34898101, 34898188-34898241,34898455-34898604,34898709-34898918, 34898980-34899039,34899399-34899527,34899616-34899720, 34899935-34900024,34900630-34900695,34901047-34901115, 34901348-34901467,34901572-34901634,34901681-34901817, 34902070-34902160,34902298-34902463,34902700-34904172, 34905666-34905940,34906322-34906819,34906996-34907145, 34907840-34907911,34908006-34908266,34908478-34908558, 34908745-34908996,34909323-34909382,34909602-34909853, 34910385-34910549,34910589-34910849,34911267-34912307, 34913398-34913457,34914055-34914165,34914448-34914534, 34915227-34915300,34915397-34915490,34915644-34915689, 34916397-34916521 Length = 2501 Score = 31.5 bits (68), Expect = 0.89 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPP + +++ PP PPPP P K Sbjct: 315 PPPSDYVRRRLLEPPRPPPPAAVNPSGK 342 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 P P KK PPPPP PPP K Sbjct: 218 PEPEPEPPKKEPPPPPPPKQEPCPPPPK 245 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/18 (66%), Positives = 12/18 (66%), Gaps = 3/18 (16%) Frame = +1 Query: 805 PPPPPPPXXXP---PPKK 849 PPPPPPP P PPKK Sbjct: 171 PPPPPPPAPEPEPEPPKK 188 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 A P P KK+ PPPP PPPK Sbjct: 215 APAPEPEPEPPKKEPPPPPPPKQEPCPPPPK 245 >02_04_0520 - 23628183-23628195,23629354-23630036 Length = 231 Score = 31.5 bits (68), Expect = 0.89 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPP+ Sbjct: 195 PPPPPPPDTAPPPQ 208 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PP +T Sbjct: 194 PPPPPPPPDTAPPPQT 209 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 31.5 bits (68), Expect = 0.89 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPP+ Sbjct: 9 PPPPPPPQHPPPPQ 22 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 8 PPPPPPPPQHPPP 20 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 338 PPPPPPPPPPPPP 350 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 736 KNIFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 +N G G P + PPPPPPP PPP T Sbjct: 317 RNAVTGDGNQPEGSNHNHQGNPPPPPPPPP---PPPPDT 352 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 264 PPPPPPPPPPPPP 276 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP P P +T Sbjct: 266 PPPPPPPPPPPMPPRT 281 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPP 825 PPP PPPPPPP Sbjct: 257 PPPQSVRPPPPPPPPPPPPP 276 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPP 26 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPP 27 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PP ++ Sbjct: 16 PPPPPPPPPPPPLRR 30 >08_02_1256 + 25645085-25645396 Length = 103 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 63 PPPPPPPLPSPPP 75 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 1157 PPPPPPPLPPPPP 1169 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 AG P P PPPPPP PPP Sbjct: 56 AGPPHAPPPQQPPAMWGQPPPPPPQYAPPP 85 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 238 PPPPPPPPPLPPP 250 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PP T Sbjct: 239 PPPPPPPPLPPPMPAT 254 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP P P+ Sbjct: 308 PPPPPPPPPPPMPR 321 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPP 22 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPP 23 >02_03_0279 + 17250347-17252098 Length = 583 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 124 PPPPPPPPPPPPP 136 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 965 PPPPPPPNVAPPP 977 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PP PPP PPP Sbjct: 984 PPPPPSPPPLPITQPPSVPPPPNSPPP 1010 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPPKKT 852 P ++ PPPPPPP PP T Sbjct: 953 PGGSAQQSEKRPPPPPPPPNVAPPPFT 979 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 76 PPPPPPPPPPPPP 88 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPPP 843 PP PPPPPPP P P Sbjct: 66 PPAGIAVHPSPPPPPPPPPPPPPVP 90 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP PPPPPPP PP Sbjct: 76 PPPPPP--------PPPPPPPVPVPP 93 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP PPPPPPP P P Sbjct: 66 PPAGIAVHPSPPPPPPPPPPPPPVPVP 92 >09_02_0569 - 10752756-10753164,10753229-10753644,10754149-10755349, 10756770-10756991,10757615-10757767,10757883-10758034, 10758142-10758222,10758353-10758598,10759394-10759516 Length = 1000 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PK Sbjct: 28 PPPPPPPLRVSNPK 41 Score = 23.0 bits (47), Expect(2) = 1.4 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPP 822 PP PPPPPP Sbjct: 17 PPRPLAAAASSPPPPPPP 34 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 P PPPPP PPP+ Sbjct: 85 PSPPPPPPPPPPPR 98 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PP PPPP PPP + Sbjct: 84 PPSPPPPPPPPPPPR 98 Score = 27.9 bits (59), Expect(2) = 1.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP P P Sbjct: 89 PPPPPPPPPRPAP 101 Score = 21.4 bits (43), Expect(2) = 1.5 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP 822 G G P PPPPPP Sbjct: 74 GDGAAPDQEPPPSPPPPPPPPPPP 97 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PP PPP PP ++T Sbjct: 117 PPPPLAETPPPMNERPPTPPPVQPPPDRET 146 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PP PP PPP + Sbjct: 116 PPPPPLAETPPPMNERPPTPPPVQPPPDR 144 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP F PPPPPPP P Sbjct: 65 AAPPPPPAAFF---AAVPPPPPPPFEYYP 90 >08_02_0937 + 22801526-22802461 Length = 311 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 P PPP ++ PPPPP P G Sbjct: 58 PNPPPEPEEEEEVSSPPPPPPPPPG 82 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP PPP Sbjct: 83 PPPPPSPPATHDVGQPPPPPSLAAPPP 109 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 790 KKXXXPPPPPPPXXXPP 840 K+ PPPPPPP PP Sbjct: 74 KQTPPPPPPPPPPPSPP 90 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP P P T Sbjct: 77 PPPPPPPPPPPSPPAT 92 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP + PPPPP Sbjct: 83 PPPPPSPPATHDVGQPPPPP 102 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 793 KXXXPPPPPPPXXXPPP 843 K PPPPPPP PP Sbjct: 74 KQTPPPPPPPPPPPSPP 90 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 38 PPPPPPSPVPSPAPPPPPHRPSPSPPP 64 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP ++ P PPP P P Sbjct: 405 PPPPPPPPHQRETPSPSPPPQPQFPCP 431 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPP PPPPP G P + P Sbjct: 263 GPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIP 296 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +1 Query: 751 GAGXPP--PPXXFXKKKXXXPPPPPP--PXXXPP 840 G+G PP PP PPPPPP P PP Sbjct: 260 GSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPP 293 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP + PPPPPPP PP+ Sbjct: 296 PPPPVGGTQ-----PPPPPPPLANGPPR 318 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PP PP PPPP PPP Sbjct: 247 ANKPPAAPGTLPNGSGGPPRPPPPQVPPPP 276 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + P PP PP PPP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPDHPPPP 145 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Frame = +1 Query: 763 PPPPXXFXKKKXXXP-----PPPPPPXXXPPP 843 PPPP P PPPPPP PPP Sbjct: 122 PPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPP 153 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PP P + PPPPPP PP Sbjct: 70 PPTPSPVPEHLHHHPPPPPPVPPCPP 95 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PP PP PPP Sbjct: 120 PPPPPPHPPEDPPPHPPHPPDHPPPPP 146 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPP-PPPXPXXGXPXKKP 853 R PPPPP + PP PP P P + P Sbjct: 118 RPPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVP 151 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPPP PPPPPPP Sbjct: 412 PPPPPTHTHGPPPPPPPPPPP 432 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPPP PPPPPPP Sbjct: 413 PPPPTHTHGPPPPPPPPPPPP 433 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP F PPPPPP PP Sbjct: 357 PPPPPPFAPTL----PPPPPPRRKPP 378 >01_01_0082 + 625198-625719 Length = 173 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPP PPP PPP Sbjct: 66 PPPPPVYY------PPPSPPPVAYPPP 86 >11_01_0359 - 2731522-2732346 Length = 274 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PP Sbjct: 52 PPPPPPHAYHHHHYPPPPPPHHHPYPP 78 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP + PPPPP P P Sbjct: 52 PPPPPPHAYHHHHYPPPPPPHHHPYPPHPPP 82 >09_04_0365 - 16962608-16963174,16963301-16963486,16963824-16963896, 16964307-16964497,16964982-16965198,16965394-16965797, 16966593-16966658,16966668-16966721,16966945-16967079, 16967194-16967391,16967734-16967918,16968990-16969527 Length = 937 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 790 KKXXXPPPPPPPXXXPPPKK 849 K PPPPPPP PP+K Sbjct: 22 KPATAPPPPPPPTPPRPPQK 41 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPP--PPXXXPPPK 846 A PPPP PPPPP PPPK Sbjct: 56 AAAPPPPAPLTPPPPKSPPPPPHIQTTDLPPPK 88 >08_02_1084 - 24232968-24234779 Length = 603 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPP PPP++ Sbjct: 79 PPPPQQQQPPPQHSLPPPPPLPQAPPPQQ 107 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKK 850 PPPP PPPPP P P ++ Sbjct: 79 PPPPQQQQPPPQHSLPPPPPLPQAPPPQQQ 108 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 790 KKXXXPPPPPPPXXXPPPKK 849 K PPPPPPP PP K Sbjct: 12 KSPLPPPPPPPPPPLPPAHK 31 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPPK 846 P K PPPPPPP P K Sbjct: 7 PDDIVKSPLPPPPPPPPPPLPPAHK 31 >07_01_0516 - 3850252-3852870 Length = 872 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP-XXXPPPKKT 852 PP P + PPPPPP PPP +T Sbjct: 16 PPQPPPTSRPLPPPPPPPPPAHGPSPPPPRT 46 >05_01_0210 + 1583176-1584177 Length = 333 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXP--PP 843 PP F PPPPPPP P PP Sbjct: 22 PPHHFAPDPLPPPPPPPPPPLLPADPP 48 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A P PP F ++ PPPP P PPP Sbjct: 17 APAPAPPQVFLRRSVL-PPPPAPHHAPPPP 45 >03_05_0161 + 21400580-21401695 Length = 371 Score = 30.3 bits (65), Expect = 2.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP ++ PPPPP Sbjct: 24 PPPPPPAQQQQQQPLPPPPP 43 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 790 KKXXXPPPPPPPXXXPPPKKT 852 K PPPPPP PPP K+ Sbjct: 538 KNMLPPPPPPPRNMLPPPPKS 558 >01_06_0969 - 33472588-33474480,33475543-33475623,33475692-33475740, 33475866-33476281,33477208-33477447 Length = 892 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPPKKT 852 P F + PPPPPPP PP KT Sbjct: 263 PSVFAPRPKPQPPPPPPP-PTPPAHKT 288 >01_01_0046 - 331758-332627 Length = 289 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPP 840 PP + PPPPPPP PP Sbjct: 9 PPQRYWFPYWTSPPPPPPPPPPPP 32 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP F PPPPPPP PPP + Sbjct: 9 PPQRYWFPYWTSPPPPPPPPP---PPPSSS 35 >02_05_1249 - 35240823-35242184 Length = 453 Score = 27.5 bits (58), Expect(2) = 2.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 811 PPPPPXXXPPPK 846 PPPPP PPPK Sbjct: 230 PPPPPPSGPPPK 241 Score = 21.0 bits (42), Expect(2) = 2.6 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 805 PPPPPP 822 PPPPPP Sbjct: 196 PPPPPP 201 >07_01_0015 + 108338-109186 Length = 282 Score = 25.4 bits (53), Expect(2) = 2.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 107 PPPPPPPPLLP 117 Score = 23.0 bits (47), Expect(2) = 2.7 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPP 822 P PP PPPPPP Sbjct: 95 PIPPTVSICAPPPPPPPPPP 114 >12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561, 9769918-9769980,9770547-9771325 Length = 665 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPP + PPPPPPP Sbjct: 24 PPPVRPYASSAASPPPPPPPP 44 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 P PPP + PPPPP P Sbjct: 22 PRPPPVRPYASSAASPPPPPPP 43 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPPP PPP T Sbjct: 215 PPPPSIATPPPSPASPPPPSTATPPPPSPT 244 >10_03_0035 - 7265037-7265455,7265684-7265812,7265909-7265951, 7266321-7266344 Length = 204 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPP 843 ++K PPPPPPP P P Sbjct: 114 REKNRVPPPPPPPPPQPAP 132 >07_01_0479 + 3606663-3607448 Length = 261 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 7/61 (11%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKK------PPGXFXGXXPXPXXK-XXXPPPXPXXGGXP 611 GG PP + PP G P + PPG G P P PPP P G Sbjct: 199 GGPPPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGPQQPGQN 258 Query: 610 P 608 P Sbjct: 259 P 259 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 690 PGGFFWXGXPPXGGXKKYIXXGGXPPP---PXXXXKKKIXXXPPPPP 821 P G F G PP G + G PPP P PPPPP Sbjct: 204 PPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPP 250 >07_01_0439 + 3333654-3334217 Length = 187 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PP K Sbjct: 35 PPPPPPPASRPPKK 48 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 808 PPPPPPXXXPPPKK 849 PPPPPP PPKK Sbjct: 35 PPPPPPPASRPPKK 48 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPPK 846 KKK PPPPPP P P+ Sbjct: 166 KKKFMFAPPPPPPPRPPAPE 185 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 781 FXKKKXXXPPPPPPPXXXPPPKK 849 + KK PPPPPPP P K Sbjct: 165 YKKKFMFAPPPPPPPRPPAPEYK 187 >02_05_0201 + 26687369-26689228 Length = 619 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPP 825 + G+ PPPP + PP PPPP Sbjct: 4 VVAGSHRPPPPPQSLRLVPPPPPQPPPP 31 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP P + PPPPPPP PP ++T Sbjct: 276 PPMPALSVCGRAAAPPPPPPP---PPARRT 302 >09_04_0192 + 15478270-15480257,15480358-15480640,15480727-15481116 Length = 886 Score = 25.4 bits (53), Expect(2) = 3.2 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPP 822 PPP PPPPPP Sbjct: 25 PPPMQLAALASDEPPPPPP 43 Score = 22.6 bits (46), Expect(2) = 3.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 808 PPPPPPXXXP 837 PPPPPP P Sbjct: 38 PPPPPPEQSP 47 >12_02_0848 + 23636478-23638058 Length = 526 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXP-PPPPXPXXGXPXKK 850 G PPPPP PPPP P G P ++ Sbjct: 61 GDTPPPPPIIDASPPPPSTSPPPPPPRRGRPARR 94 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + + P PPPP P P Sbjct: 70 PPPPQPQPEPQPAAPSQPPPPQEQPSP 96 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 808 PPPPPPXXXPPPKKT 852 PPPPPP PPP T Sbjct: 127 PPPPPPHPLPPPPPT 141 >08_02_1143 + 24659105-24659386,24660171-24660272,24661259-24661521, 24661775-24661874,24662080-24662238,24662327-24663147, 24663299-24663618,24665831-24667398 Length = 1204 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P + PPPPPPP P Sbjct: 709 PPSPPHLRIPRPWPPPPPPPPRRRAEP 735 >07_01_0662 + 4972953-4973645,4973758-4974046,4974790-4974803, 4974848-4974856 Length = 334 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXP 826 R PPPPP PPPP P Sbjct: 202 RPPPPPPGYIEPPQGYIEPPPPEP 225 >07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922, 2916053-2916113,2916243-2916365,2916505-2916537, 2916617-2916709,2916839-2916934,2917025-2917203, 2917344-2917530,2918051-2918184,2918311-2918518, 2918598-2918633,2918785-2919241,2919633-2919736, 2920489-2920569,2920646-2920697,2920837-2920876, 2920991-2921085,2921241-2921383,2921899-2922006, 2922120-2922221,2922302-2922348,2922425-2922554, 2923173-2923304,2923404-2923616,2923709-2923963, 2924053-2924799 Length = 1460 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 781 FXKKKXXXPPPPPPPXXXPPPK 846 F ++K PPPPP PPP+ Sbjct: 3 FLQRKRPPQPPPPPSPPNPPPR 24 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPPP 843 PP + PPPPP P PPP Sbjct: 36 PPPSRPEPDQAAPPPPPQPHTAPPP 60 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPP---PXXXPPPK 846 A PPPP + PPPPPP P PPP+ Sbjct: 46 AAPPPPP-----QPHTAPPPPPPNAEPEAPPPPQ 74 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPP P PPP Sbjct: 36 PPPSRPEPDQAAPPPPPQPHTAPPPP 61 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP K PPPP P Sbjct: 1935 PPPPPVEGKPKPPPHAPPPPPP 1956 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 A PPPP + K PP PPP PPP+ Sbjct: 1930 APPPPPPPPPVEGKPKPPPHAPPP---PPPE 1957 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K K PPP PP P KK+ Sbjct: 1935 PPPPPVEGKPK---PPPHAPPPPPPEAKKS 1961 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 808 PPPPPPXXXPPPKKT 852 PPPPPP PPP T Sbjct: 117 PPPPPPPPPPPPTTT 131 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 P PPPPP PPP T Sbjct: 115 PSPPPPPPPPPPPPTT 130 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PP T Sbjct: 117 PPPPPPPPPPPPTTTT 132 >05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149, 2754692-2754775,2755780-2757548 Length = 892 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPP 819 PPPP F ++ PPPPP Sbjct: 768 PPPPPPFSVQQQQLPPPPP 786 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP P P K Sbjct: 80 PPPPPPPRNSPSPPK 94 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP +N PP PP Sbjct: 77 PPPPPPPPPPRNSPSPPKPP 96 >04_04_1216 + 31811403-31812267,31813187-31813877,31813981-31814131, 31814289-31814351,31814590-31814664,31814934-31815032 Length = 647 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP K+ P PP PPP +T Sbjct: 220 PPPPEMNRFKRLRRGPAPPSQAPTPPPHRT 249 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 8/41 (19%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPP----PPPP----XXXPPP 843 + GA PPPP + PPP PPPP PPP Sbjct: 419 YMGAPPPPPPGSYAPVPWGQPPPYASYPPPPPGSSMYNPPP 459 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPP P PPP Sbjct: 443 ASYPPPPPG---SSMYNPPPPAPGQATPPP 469 >04_01_0354 - 4646826-4647314 Length = 162 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 P P PPPPPP PPP++ Sbjct: 79 PNPRPHPLPNLNLSPPPPPPPPPPPPQQ 106 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PP ++ Sbjct: 93 PPPPPPPPPPPPQQQ 107 >03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 Length = 697 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 P PPPPP PPP K Sbjct: 14 PTPPPPPPPPPPPAK 28 >02_03_0132 - 15584673-15584789,15584957-15585054,15585151-15585550 Length = 204 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 763 PPP--PXXFXKKKXXXPPPPPPPXXXPPPK 846 PPP P F PPPPP PPP+ Sbjct: 77 PPPTIPVKFSPPAAPVKVPPPPPVQVPPPQ 106 >02_01_0674 + 5020118-5020202,5020301-5020436,5021075-5021140, 5021219-5021290,5021362-5021433,5024242-5024301, 5024494-5024565,5024655-5024720,5024798-5024863, 5024945-5025273,5025713-5025969,5026213-5026484, 5026580-5026715,5026833-5026972,5027051-5027207, 5027476-5027634 Length = 714 Score = 29.5 bits (63), Expect = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 P PPPPP PPP++ Sbjct: 242 PAPPPPPFMPPPPRR 256 >03_06_0600 + 34988743-34989407,34990033-34990051 Length = 227 Score = 24.2 bits (50), Expect(2) = 4.6 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PP PPPPPPP Sbjct: 140 PPGSAASPSVSCPPPPPPPPP 160 Score = 23.4 bits (48), Expect(2) = 4.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 811 PPPPPXXXPPPKK 849 PPPPP P P++ Sbjct: 152 PPPPPPPPPGPRR 164 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +G P + PPPPPP PPP Sbjct: 21 SGSDPDDPLLRDRVVVIAPPPPPPPPPPPP 50 >08_02_0703 - 20188489-20190246 Length = 585 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPP 840 PP K+K PPPPP P P Sbjct: 14 PPFHSAKRKPPLPPPPPAPVAVAP 37 >07_03_1788 + 29523216-29524867,29525048-29525075 Length = 559 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPPP 843 PP + PPPPPPP P P Sbjct: 18 PPKRGRGRPRKNPPPPPPPATDPNP 42 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPP 825 PPP + PPPPPPP Sbjct: 151 PPPCGDANENPPPPPPPPPP 170 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP + PPPPPP PPP Sbjct: 28 PPNQPYYAFPAAAYAPPPPPPPPPPPP 54 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPPP PPP Sbjct: 27 PPPNQPYYAFPAAAYAPPPPPPPPPPP 53 >05_06_0063 + 25289117-25290643 Length = 508 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 808 PPPPPPXXXPPPKK 849 PPPPPP PPP++ Sbjct: 325 PPPPPPFPPPPPQQ 338 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 A PP P PPPPPPP P+ Sbjct: 332 APPPPAPSPSAAGAGSGPPPPPPPAAPAAPR 362 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXP--XXKXXXPPPXPXXGGXP 611 G G PP PP P +PPG G P P + PP P G P Sbjct: 344 GAGSGPPP------PPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALPGGP 393 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GAG PPP PP P P PPP Sbjct: 344 GAGSGPPPPPPPAAPAAPRPPGPGPGPPPPP 374 >03_05_0843 + 28126480-28127007,28127092-28127457,28129388-28129487, 28130266-28130546,28130643-28130705,28131276-28131431, 28131913-28132080,28132158-28132298,28132714-28132840, 28132888-28132994,28134142-28134372,28134446-28134559, 28135091-28135261 Length = 850 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 808 PPPPPPXXXPPPK 846 PPPPPP PPP+ Sbjct: 38 PPPPPPLPPPPPR 50 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPP-----PPPPXXXPPP 843 AG PPPP + + PP PPPP PPP Sbjct: 23 AGPPPPPPQYFQ--GAHPPAAMWGQPPPPQAAPPP 55 >03_04_0042 - 16743440-16743454,16743907-16744002,16744257-16744475, 16744830-16744910,16745092-16745187,16745981-16746045, 16746131-16746217,16746522-16746720 Length = 285 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPP + P PPPPP PPP+ Sbjct: 2 PPPTALLPGRSAAPRPPPPP--PPPPQ 26 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP PPP PP PPP+ T Sbjct: 266 PPPPLPVPG--VICRPPPSPPYFAPPPRAT 293 >01_06_1827 + 40169001-40169263,40169358-40169472,40170090-40170201, 40170556-40170623,40170798-40170852,40170948-40171027, 40171811-40171924,40172178-40172296,40173064-40173181, 40173264-40173394,40173535-40173688,40173922-40174017 Length = 474 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP 837 PPP PPPPPPP P Sbjct: 26 PPPRTRVRPPPPPAPPPPPPPRLEP 50 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPP P PPP+ Sbjct: 34 PPPPPAPPPPPPPR 47 >01_06_1402 + 37052996-37053449,37053533-37053630,37053718-37053888, 37054017-37054117,37054928-37055063,37055155-37055205, 37055311-37055598,37055896-37056130,37056408-37056523, 37057300-37057496,37057739-37057745 Length = 617 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP P PPPP PPP +T Sbjct: 82 PPPPAAAAANAEAKPQPPPP----PPPART 107 >01_06_1330 - 36361275-36361448,36361778-36361973,36362248-36362325, 36362685-36362807,36363206-36363463,36363914-36364073, 36364702-36364812,36365159-36365429,36365514-36365663, 36366383-36367090 Length = 742 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PP PPPPPP PPP Sbjct: 86 ASTPPASPTANASPPPSLPPPPPPLRPPPP 115 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 25.0 bits (52), Expect(2) = 5.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP P Sbjct: 220 PPPPPPPPDSKP 231 Score = 22.2 bits (45), Expect(2) = 5.3 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPP 822 P P + PPPPPP Sbjct: 208 PAPGTPVTPQPPPPPPPPPP 227 >11_01_0021 - 143576-143932,144434-144667,144988-145066,145138-145253, 145717-145861,146048-146465,147206-147869 Length = 670 Score = 23.8 bits (49), Expect(2) = 5.4 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 68 PPPPPP--GPPP 77 Score = 23.4 bits (48), Expect(2) = 5.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 781 FXKKKXXXPPPPPPP 825 F + K PPPP PP Sbjct: 62 FRRTKHPPPPPPGPP 76 >01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567, 9255344-9255487,9255514-9255622 Length = 537 Score = 25.4 bits (53), Expect(2) = 5.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 206 PPPPPPPPRCP 216 Score = 21.8 bits (44), Expect(2) = 5.5 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPP 822 P ++ PPPPPP Sbjct: 197 PFPAPTRRPPPPPPPPP 213 >08_02_0839 + 21693348-21694853 Length = 501 Score = 24.6 bits (51), Expect(2) = 5.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPP 825 PP PPPPPPP Sbjct: 16 PPTSPLQLPLPYLPPPPPPP 35 Score = 22.6 bits (46), Expect(2) = 5.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 808 PPPPPPXXXP 837 PPPPPP P Sbjct: 29 PPPPPPPQPP 38 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 26 PPPPPPPPPPPP 37 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 26 PPPPPPPPPPPP 37 Score = 25.0 bits (52), Expect(2) = 5.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP P++ Sbjct: 29 PPPPPPPPPANVPRE 43 Score = 22.2 bits (45), Expect(2) = 5.7 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPP 819 PP P PPPPP Sbjct: 19 PPAPAPVPPPPPPPPPPPP 37 >12_02_1070 - 25814741-25815850 Length = 369 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP + PPPPPPP PPP Sbjct: 226 PPKIRLSPTQAPPPPPPPPP---PPP 248 >12_02_0408 + 18659494-18660362,18660472-18660634,18660976-18661139, 18661253-18661511,18661605-18661712 Length = 520 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PP + Sbjct: 147 PPPPPPPPQAPPAR 160 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PP + Sbjct: 146 PPPPPPPPPQAPPAR 160 >12_01_0742 - 6656464-6656739 Length = 91 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G PPPP + + P P PP PP Sbjct: 56 GRPPPPLPLDRAEGRAPQPLLPPGIRPP 83 >11_01_0429 - 3288081-3288781,3290038-3290293 Length = 318 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 781 FXKKKXXXPPPPPPPXXXPPPKKT 852 F + PPPPPPP P P ++ Sbjct: 186 FPEDAALLPPPPPPPAPAPAPPQS 209 >10_08_0638 - 19503580-19503990 Length = 136 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 808 PPPPPPXXXPPPK 846 PPPPPP PPP+ Sbjct: 114 PPPPPPRKKPPPQ 126 >10_08_0543 - 18649894-18650233,18651446-18651981 Length = 291 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP ++ PPPP P Sbjct: 120 PPPPPARPREEPSEEAPPPPEP 141 >10_08_0520 - 18495118-18498237 Length = 1039 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PP + Sbjct: 91 PPPPPPPSAQPPAR 104 >10_07_0053 - 12406958-12407011,12407012-12407168,12407280-12407410, 12407592-12407727,12407953-12408224,12408604-12408893, 12408984-12409285,12409359-12409424,12409506-12409571, 12409855-12409926,12410013-12410084,12410207-12410281, 12410367-12410438,12410531-12410663,12411556-12411655 Length = 665 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 P PPPPP PPP + Sbjct: 229 PAPPPPPFTAPPPSR 243 >10_04_0005 + 7390697-7390705,7390943-7391096,7391225-7391424, 7391649-7391739,7392042-7392385 Length = 265 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP +KK P PPP PPK Sbjct: 99 PPPPEE--EKKEEAPAPPPEEKKEEPPK 124 >10_02_0009 + 4128909-4130123 Length = 404 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PP PPPP PPP++ Sbjct: 81 PPSPPPPPPPPPPQQ 95 >09_04_0506 - 18188785-18190599 Length = 604 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGG--XPPPP 773 GG P G GGG + G G + G P GG + + GG PPPP Sbjct: 317 GGGPGGGGGGGGGGNWGRGGGGMGGRGQAGNMRNRMGPVGG-RGLMGNGGMVAPPPP 372 >06_03_0447 + 20878444-20878821 Length = 125 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 736 KNIFXGAGXPPP---PXXFXKKKXXXPPPPPPPXXXPPP 843 + I G PPP P + + PPPPP P PP Sbjct: 40 RQIDGGKAPPPPRPIPPDLVEGRALAPPPPPLPLTTLPP 78 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 754 AGXPPPPXX--FXKKKXXXPPPPPPPXXXPPPKKT 852 A PPPP K K PPPPPP PP T Sbjct: 65 AKEPPPPTKPKHPKPKQQQHPPPPPP-QKPPQGST 98 >04_03_1022 - 21778315-21779007 Length = 230 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPP 840 PP PPPPPPP PP Sbjct: 27 PPCSSAHLLPPPPPPPPPPPYVPP 50 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP P P T Sbjct: 129 PPPPPPPARTPMPTPT 144 >04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064, 6542113-6542322,6542507-6542765,6544022-6544215 Length = 511 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 764 PPPPXXXXKKNXXXPPPPPXPXXG 835 PPPP ++ PPPPP G Sbjct: 36 PPPPPGPLQRRSSLPPPPPLDLEG 59 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPP 817 PPPPP +++ PPPP Sbjct: 36 PPPPPGPLQRRSSLPPPPP 54 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 PPPP + PPPPPP Sbjct: 363 PPPPVYYSSYVMLDRPPPPPP 383 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 355 PPPPPPPPPPPP 366 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 355 PPPPPPPPPPPP 366 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 808 PPPPPPXXXPPPK 846 PPPPPP PPP+ Sbjct: 428 PPPPPPPPPPPPQ 440 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 428 PPPPPPPPPPPP 439 >02_04_0021 + 18975992-18976408 Length = 138 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPP-----PPPPXXXPPPKK 849 PPPP K K PPP PP P PPP K Sbjct: 97 PPPP----KPKPTPPPPAPTPKPPAPSPSPPPPK 126 >02_04_0001 - 18816492-18816741,18816881-18817050,18817244-18817388, 18817495-18817565,18817910-18817993,18818103-18818222, 18818310-18818480,18818955-18819044,18821893-18821985, 18822073-18822405 Length = 508 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPP 825 A P PP PPPPPPP Sbjct: 33 ASIPAPPEGAGDVSPPSPPPPPPP 56 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP KK PPP PP P P Sbjct: 111 PPPPPR--KKPQFQPPPQPPRAWDPSP 135 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP P P P P Sbjct: 135 PPPPPPAPAAPVLVPPPAPAPRPAPAP 161 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PP+ Sbjct: 4 PPPPPPPPPPSPPR 17 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 2 PPPPPPPPPPPP 13 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 2 PPPPPPPPPPPP 13 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP P P + Sbjct: 3 PPPPPPPPPPPSPPR 17 >01_01_0796 + 6190931-6192745 Length = 604 Score = 28.7 bits (61), Expect = 6.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP P P++ Sbjct: 193 PPPPPPPPPPPQPEQ 207 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP KK PP PPP PP Sbjct: 82 PPPPTP---KKAPPPPVTPPPVTPPP 104 >12_02_1119 + 26213719-26213955,26214039-26214197,26214640-26214702, 26214813-26214902,26214984-26215106,26215344-26215431, 26217043-26217117,26218109-26218215 Length = 313 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PP T Sbjct: 15 PPPPPPPPPNSPPFAT 30 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXP 837 PPPP + PPPPPPP P Sbjct: 148 PPPPPP----QESTPPPPPPPPPAP 168 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP +++ PPPPP P Sbjct: 148 PPPPPP---QESTPPPPPPPPP 166 >12_01_0495 - 3935395-3937110 Length = 571 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPP PPP PPP T Sbjct: 6 PPPLPPPPPPPPPPAT 21 >10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 Length = 474 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 321 PPPPPPPPPVPP 332 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 239 PPPPPPPSLLPP 250 >09_06_0148 - 21214460-21214561,21214993-21215339,21215428-21215538, 21215673-21215835,21215921-21215999,21216110-21216228 Length = 306 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 196 PPPPPPAAPPPP 207 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + P PPP P PPP Sbjct: 45 PPPPTPAPQSS---PAPPPAPDMTPPP 68 >08_02_1334 - 26224546-26225337 Length = 263 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 123 PPPPPPPPETPP 134 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 20 PPPPPPPPPLPP 31 >08_01_0060 - 413088-413999 Length = 303 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 29 PPPPPPPPPPPP 40 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 29 PPPPPPPPPPPP 40 >07_03_1090 + 23891294-23892222,23892317-23892516,23895241-23895482, 23895771-23896461,23896486-23896562 Length = 712 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP 825 P PP + PPPPPPP Sbjct: 211 PAPPQTNPPRPVRPPPPPPPP 231 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPP P PPPPP P + P Sbjct: 585 PPPEPSPPPAPKAAPPPPPPKSTGPGPPRPP 615 >07_01_0862 - 7172083-7172931 Length = 282 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPP 820 PPPPP KK PPP P Sbjct: 132 PPPPPTAEEKKLLLFPPPLP 151 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PP KKK PP PPP P + T Sbjct: 173 PPPLPPKKKPLPPPSPPPQPPLPEKENT 200 >06_03_1368 - 29612463-29612638,29613135-29613222,29613334-29613474, 29613561-29613595,29613990-29614054,29614286-29614335, 29614417-29614521,29614608-29614688,29614771-29614852, 29614941-29614995,29615111-29616164,29617202-29617289, 29617379-29617485,29617568-29617686,29617784-29617994 Length = 818 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPP P PPPPP PP Sbjct: 13 PPPGAAAADPPESTPAPPPPPPLEPP 38 >06_03_1006 + 26844161-26844198,26844304-26844372,26844526-26844591, 26844831-26844902,26844982-26845053,26846179-26846244, 26846409-26846881,26846966-26847324,26847429-26847697, 26847780-26847918,26848323-26848462,26848612-26848768, 26848925-26848978,26849457-26849539,26851085-26851136 Length = 702 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 326 PPPPPPPPFLPP 337 >05_04_0156 - 18598926-18599177 Length = 83 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPP PPP + Sbjct: 60 PPPPPPARSSPPPSSS 75 >05_02_0099 - 6582498-6582725,6583148-6583235,6583437-6583830, 6585855-6585990,6586413-6586931 Length = 454 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPP 843 P + PPP PPP PPP Sbjct: 57 PKHHRRSSSSSPPPMPPPLPPPPP 80 >05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102, 3003571-3004442,3004592-3004773,3005206-3005295, 3005388-3005675,3005776-3005997,3006053-3006133, 3006634-3006861 Length = 1475 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 579 PPPPPPPPPPPP 590 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 579 PPPPPPPPPPPP 590 >04_04_0675 + 27183826-27184443 Length = 205 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPP PP PPPKK Sbjct: 109 PPPPAS--------PPPLPPAPSSPPPKK 129 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 549 PPPPPPPPPPPP 560 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 549 PPPPPPPPPPPP 560 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 173 PPPPPPPAIWPP 184 >03_05_0865 - 28365430-28367640 Length = 736 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PP+ Sbjct: 48 PPPPPPPPLSNPPR 61 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP P P+ Sbjct: 54 PPPPPPPPPLPQPQ 67 >03_05_0019 + 19862171-19863049 Length = 292 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXP 826 R P PPP ++ PPP P P Sbjct: 175 RPPEPPPKTTQRQQPPGPPPKPQP 198 >03_04_0191 - 18293842-18294273 Length = 143 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 A PPPP F K P PPP P Sbjct: 46 AAPPPPPPQFVKHFAPPAPVTPPPHPQP 73 >03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021, 5103670-5104577 Length = 538 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPP-PPPPPXXXPPP 843 AG PPP P PPPPP P P Sbjct: 199 AGAPPPQAPLPPPAPVPAPAPPPPPAAAPAP 229 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGG 617 PP Y+ PP P PP P P PPP P GG Sbjct: 48 PPSPEYYDPPPS---PDYYDPPHSPDYYDPPPSPDYYDPPPSPYYGG 91 >01_06_1377 + 36764461-36765339 Length = 292 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPP PPP Sbjct: 163 PPPS---SSPYYFPPPPPPAYSAPPP 185 >01_06_1321 + 36280691-36281269 Length = 192 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 148 PPPPPPPPPLPP 159 >01_05_0535 - 23001864-23005052 Length = 1062 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 PPPPPP PPP Sbjct: 29 PPPPPPRRLPPP 40 >01_01_1101 + 8731427-8732938 Length = 503 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 805 PPPPPPPXXXPP 840 PPPPPPP PP Sbjct: 2 PPPPPPPPSLPP 13 >11_05_0093 + 18992027-18993514 Length = 495 Score = 25.0 bits (52), Expect(2) = 9.3 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +1 Query: 787 KKKXXXPPPPPPP 825 +++ PPPPPPP Sbjct: 368 RRRKPNPPPPPPP 380 Score = 21.4 bits (43), Expect(2) = 9.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 808 PPPPPPXXXPPP 843 P PPPP P P Sbjct: 372 PNPPPPPPPPTP 383 >09_01_0037 - 604001-604957 Length = 318 Score = 23.8 bits (49), Expect(2) = 9.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 805 PPPPPPP 825 PPPPPPP Sbjct: 193 PPPPPPP 199 Score = 22.6 bits (46), Expect(2) = 9.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 814 PPPPXXXPPP 843 PPPP PPP Sbjct: 232 PPPPSQMPPP 241 >03_03_0262 + 15968884-15969687 Length = 267 Score = 24.2 bits (50), Expect(2) = 9.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPP 817 PPPPP ++ PP P Sbjct: 183 PPPPPSSHHQQQPAFPPQP 201 Score = 22.2 bits (45), Expect(2) = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 806 PPPPPXPXXG 835 PPPPP P G Sbjct: 232 PPPPPAPAQG 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,576,570 Number of Sequences: 37544 Number of extensions: 629671 Number of successful extensions: 14073 Number of sequences better than 10.0: 202 Number of HSP's better than 10.0 without gapping: 2418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7745 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -