BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_E01 (861 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 38 0.018 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 38 0.018 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 38 0.018 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 38 0.018 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 38 0.023 BT023644-1|AAY85044.1| 114|Drosophila melanogaster IP05560p pro... 37 0.031 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 37 0.031 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 37 0.031 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 37 0.031 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 37 0.031 AE013599-3023|AAF57461.1| 114|Drosophila melanogaster CG13428-P... 37 0.031 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 37 0.041 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 37 0.041 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 37 0.041 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 37 0.041 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 37 0.041 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 37 0.041 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 37 0.041 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 37 0.041 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 37 0.041 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 36 0.072 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 36 0.072 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 36 0.072 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 36 0.072 BT015290-1|AAT94519.1| 313|Drosophila melanogaster GH12715p pro... 36 0.095 BT003175-1|AAO24930.1| 313|Drosophila melanogaster RH66362p pro... 36 0.095 BT001413-1|AAN71168.1| 324|Drosophila melanogaster GH11283p pro... 36 0.095 AY060346-1|AAL25385.1| 316|Drosophila melanogaster GH26622p pro... 36 0.095 AE013599-1605|AAM68615.1| 316|Drosophila melanogaster CG3798-PF... 36 0.095 AE013599-1604|AAM68616.2| 324|Drosophila melanogaster CG3798-PE... 36 0.095 AE013599-1603|AAM68614.1| 324|Drosophila melanogaster CG3798-PD... 36 0.095 AE013599-1602|AAF58446.1| 324|Drosophila melanogaster CG3798-PC... 36 0.095 AE013599-1601|AAM68613.1| 313|Drosophila melanogaster CG3798-PB... 36 0.095 AE013599-1600|AAM68612.1| 313|Drosophila melanogaster CG3798-PA... 36 0.095 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 35 0.17 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 35 0.17 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 35 0.17 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 35 0.17 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 35 0.17 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 35 0.17 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 35 0.17 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 35 0.17 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 35 0.17 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 35 0.17 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 35 0.17 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 34 0.22 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 34 0.22 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 34 0.22 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 34 0.22 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 34 0.29 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 34 0.29 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 34 0.29 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 33 0.38 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 33 0.38 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 33 0.50 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 33 0.50 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 33 0.50 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 33 0.50 U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. 32 0.88 AY118390-1|AAM48419.1| 873|Drosophila melanogaster RE39020p pro... 32 0.88 AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p pro... 32 0.88 AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D pro... 32 0.88 AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC... 32 0.88 AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB... 32 0.88 AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA... 32 0.88 AE013599-3085|AAF46639.3| 873|Drosophila melanogaster CG10052-P... 32 0.88 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 32 1.2 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 32 1.2 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 32 1.2 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 32 1.2 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 31 1.5 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 31 1.5 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 31 1.5 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 31 1.5 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 31 1.5 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 31 1.5 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 31 1.5 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 31 1.5 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 31 1.5 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 31 1.5 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 31 1.5 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 31 1.5 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 31 1.5 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 31 2.0 AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p pro... 31 2.0 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 31 2.0 AY094826-1|AAM11179.1| 1266|Drosophila melanogaster LD39940p pro... 31 2.0 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 31 2.0 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 31 2.0 AY051631-1|AAK93055.1| 506|Drosophila melanogaster GH28016p pro... 31 2.0 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 31 2.0 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 31 2.0 AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-P... 31 2.0 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 31 2.0 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 31 2.0 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 31 2.0 AE013599-2106|AAF58108.2| 1263|Drosophila melanogaster CG30089-P... 31 2.0 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 25 2.5 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 25 2.6 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 31 2.7 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 31 2.7 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 25 2.8 L14768-1|AAB39774.1| 1429|Drosophila melanogaster expanded protein. 30 3.6 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 30 3.6 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 30 3.6 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 30 3.6 AY069068-1|AAL39213.1| 1427|Drosophila melanogaster GH08582p pro... 30 3.6 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 30 3.6 AE014134-106|AAF51495.1| 1427|Drosophila melanogaster CG4114-PA ... 30 3.6 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 30 4.7 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 30 4.7 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 30 4.7 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 30 4.7 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 30 4.7 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 30 4.7 AE014134-231|AAF51393.1| 80|Drosophila melanogaster CG5011-PA ... 30 4.7 AE013599-3331|AAM68208.2| 761|Drosophila melanogaster CG13503-P... 30 4.7 AE013599-1064|AAM68780.2| 1734|Drosophila melanogaster CG18408-P... 30 4.7 AB053479-1|BAB62018.1| 1743|Drosophila melanogaster DCAPL2 protein. 30 4.7 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 29 6.2 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 29 6.2 BT016162-1|AAV37047.1| 702|Drosophila melanogaster AT08270p pro... 29 6.2 AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 p... 29 6.2 AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA... 29 6.2 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 29 6.2 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 29 6.2 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 29 6.2 AE013599-2521|AAF57825.3| 702|Drosophila melanogaster CG11423-P... 29 6.2 BT021370-1|AAX33518.1| 884|Drosophila melanogaster LP07893p pro... 29 8.2 BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p pro... 29 8.2 BT004503-1|AAO42667.1| 2201|Drosophila melanogaster GH07949p pro... 29 8.2 AY060485-1|AAL25524.1| 696|Drosophila melanogaster SD09360p pro... 29 8.2 AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. 29 8.2 AE014298-2950|ABC67193.1| 1456|Drosophila melanogaster CG32529-P... 29 8.2 AE014298-2949|AAF49024.2| 1280|Drosophila melanogaster CG32529-P... 29 8.2 AE014298-2947|AAF49026.2| 2529|Drosophila melanogaster CG32529-P... 29 8.2 AE014298-2790|AAF48905.2| 437|Drosophila melanogaster CG7349-PA... 29 8.2 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 29 8.2 AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-P... 29 8.2 AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-P... 29 8.2 AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-P... 29 8.2 AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-P... 29 8.2 AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-P... 29 8.2 AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB... 29 8.2 AE014297-2397|AAS65166.1| 2556|Drosophila melanogaster CG7467-PC... 29 8.2 AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA... 29 8.2 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 29 8.2 BT029293-1|ABK30930.1| 681|Drosophila melanogaster RT01152p pro... 25 9.3 BT029292-1|ABK30929.1| 681|Drosophila melanogaster RT01151p pro... 25 9.3 BT029291-1|ABK30928.1| 681|Drosophila melanogaster RT01150p pro... 25 9.3 AE014297-3156|AAF55998.2| 681|Drosophila melanogaster CG31160-P... 25 9.3 BT030107-1|ABN49246.1| 635|Drosophila melanogaster GH13974p pro... 25 9.4 BT010123-1|AAQ22592.1| 489|Drosophila melanogaster AT19280p pro... 25 9.6 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 37.9 bits (84), Expect = 0.018 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P P Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 37.1 bits (82), Expect = 0.031 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 G G PPPP + PPPPPPP PPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 35.9 bits (79), Expect = 0.072 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P Sbjct: 522 GAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPP 555 Score = 34.3 bits (75), Expect = 0.22 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP + PPPPPPP Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 33.9 bits (74), Expect = 0.29 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GGG PP GG P PP P P PPP P GG PP Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP------PPPPPGMGGPPP 568 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPPP P Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 542 PPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPP P Sbjct: 562 GMGGPPPPPMPGMMRPGGGPPPPPMMMGP 590 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 37.9 bits (84), Expect = 0.018 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P P Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 37.1 bits (82), Expect = 0.031 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 G G PPPP + PPPPPPP PPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 35.9 bits (79), Expect = 0.072 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P Sbjct: 522 GAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPP 555 Score = 34.3 bits (75), Expect = 0.22 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP + PPPPPPP Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 33.9 bits (74), Expect = 0.29 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GGG PP GG P PP P P PPP P GG PP Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP------PPPPPGMGGPPP 568 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPPP P Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 542 PPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPP P Sbjct: 562 GMGGPPPPPMPGMMRPGGGPPPPPMMMGP 590 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 37.9 bits (84), Expect = 0.018 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P P Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 37.1 bits (82), Expect = 0.031 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 G G PPPP + PPPPPPP PPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 35.9 bits (79), Expect = 0.072 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P Sbjct: 522 GAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPP 555 Score = 34.3 bits (75), Expect = 0.22 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP + PPPPPPP Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 33.9 bits (74), Expect = 0.29 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GGG PP GG P PP P P PPP P GG PP Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP------PPPPPGMGGPPP 568 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPPP P Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 542 PPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPP P Sbjct: 562 GMGGPPPPPMPGMMRPGGGPPPPPMMMGP 590 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 37.9 bits (84), Expect = 0.018 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P P Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 37.1 bits (82), Expect = 0.031 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP--XXXPPP 843 G G PPPP + PPPPPPP PPP Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 35.9 bits (79), Expect = 0.072 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 G PPPPP + PPPPP P G P Sbjct: 522 GAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPP 555 Score = 34.3 bits (75), Expect = 0.22 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPP 825 G PPPP + PPPPPPP Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 33.9 bits (74), Expect = 0.29 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 GGG PP GG P PP P P PPP P GG PP Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP------PPPPPGMGGPPP 568 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPPP P Sbjct: 520 GGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 542 PPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 G G PPPP + PPPPP P Sbjct: 562 GMGGPPPPPMPGMMRPGGGPPPPPMMMGP 590 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 37.5 bits (83), Expect = 0.023 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPP + PPPPPPP PPP T Sbjct: 215 PPPFYKPSRPNRRPPPPPPPPPPPPPPPT 243 Score = 34.3 bits (75), Expect = 0.22 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P PP + + PPPPPP PPP Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPPPPPPP 239 Score = 34.3 bits (75), Expect = 0.22 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPPPPPP PPP Sbjct: 215 PPPFYKPSRPNRRPPPPPPPPPPPPPP 241 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 P PPP + PPPPP P P Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPPPPPPP 239 >BT023644-1|AAY85044.1| 114|Drosophila melanogaster IP05560p protein. Length = 114 Score = 37.1 bits (82), Expect = 0.031 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F +++ P PPPP PPP Sbjct: 83 PPPPPQFRQRRQAPPGMPPPPDGLPPP 109 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 37.1 bits (82), Expect = 0.031 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPP 396 Score = 33.9 bits (74), Expect = 0.29 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPPPP 397 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 37.1 bits (82), Expect = 0.031 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 337 PPPPPVSAPVVAPPPPPPPPPAAVPPP 363 Score = 33.9 bits (74), Expect = 0.29 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 338 PPPPVSAPVVAPPPPPPPPPAAVPPPP 364 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 37.1 bits (82), Expect = 0.031 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPP 396 Score = 33.9 bits (74), Expect = 0.29 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPPPP 397 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 37.1 bits (82), Expect = 0.031 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPP 396 Score = 33.9 bits (74), Expect = 0.29 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPPPP 397 >AE013599-3023|AAF57461.1| 114|Drosophila melanogaster CG13428-PA protein. Length = 114 Score = 37.1 bits (82), Expect = 0.031 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP F +++ P PPPP PPP Sbjct: 83 PPPPPQFRQRRQAPPGMPPPPDGLPPP 109 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 36.7 bits (81), Expect = 0.041 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPP 512 Score = 35.1 bits (77), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 504 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 534 Score = 33.9 bits (74), Expect = 0.29 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP PPPPPPP PP Sbjct: 484 APPPPPPPPPLPAFVAPPPPPPPPPPPPP 512 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPP 511 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 506 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 536 Score = 32.7 bits (71), Expect = 0.67 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP PPPPP P G Sbjct: 519 PPPPPPPPPGSGSAPPPPPPAPIEG 543 Score = 32.3 bits (70), Expect = 0.88 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 G PPPPP + PPPPP P P K Sbjct: 530 GSAPPPPPPAPIEGGGGIPPPPP-PMSASPSK 560 Score = 31.1 bits (67), Expect = 2.0 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP F PP P PP G P P PPP P G PP Sbjct: 491 PPPLPAFVAPPPPPPPPPPPPPLANYGAPPPP------PPPPPGSGSAPP 534 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 751 GAGX-PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+G PPPP + PPPPPP P K T Sbjct: 528 GSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTT 562 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 508 PPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 538 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 507 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 537 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP 822 G PPPP PPPPPP Sbjct: 517 GAPPPPPPPPPGSGSAPPPPPP 538 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 36.7 bits (81), Expect = 0.041 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPP 607 Score = 35.5 bits (78), Expect = 0.095 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 599 PPPPPPPPPMANYGAPPPPPPPPPGSGSAPP 629 Score = 33.9 bits (74), Expect = 0.29 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP PPPPPPP PP Sbjct: 579 APPPPPPPPPLPAFVAPPPPPPPPPPPPP 607 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPP 606 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 601 PPPPPPPMANYGAPPPPPPPPPGSGSAPPPP 631 Score = 32.7 bits (71), Expect = 0.67 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP PPPPP P G Sbjct: 614 PPPPPPPPPGSGSAPPPPPPAPIEG 638 Score = 32.3 bits (70), Expect = 0.88 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 G PPPPP + PPPPP P P K Sbjct: 625 GSAPPPPPPAPIEGGGGIPPPPP-PMSASPSK 655 Score = 31.5 bits (68), Expect = 1.5 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP F PP P PP G P P PPP P G PP Sbjct: 586 PPPLPAFVAPPPPPPPPPPPPPMANYGAPPPP------PPPPPGSGSAPP 629 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 751 GAGX-PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+G PPPP + PPPPPP P K T Sbjct: 623 GSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTT 657 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 603 PPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 633 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 602 PPPPPPMANYGAPPPPPPPPPGSGSAPPPPP 632 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP 822 G PPPP PPPPPP Sbjct: 612 GAPPPPPPPPPGSGSAPPPPPP 633 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 36.7 bits (81), Expect = 0.041 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP PPP Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPP 740 Score = 35.5 bits (78), Expect = 0.095 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 732 PPPPPPPPPMANYGAPPPPPPPPPGSGSAPP 762 Score = 33.9 bits (74), Expect = 0.29 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP PPPPPPP PP Sbjct: 712 APPPPPPPPPLPAFVAPPPPPPPPPPPPP 740 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP PPP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPP 739 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 734 PPPPPPPMANYGAPPPPPPPPPGSGSAPPPP 764 Score = 32.7 bits (71), Expect = 0.67 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP PPPPP P G Sbjct: 747 PPPPPPPPPGSGSAPPPPPPAPIEG 771 Score = 32.3 bits (70), Expect = 0.88 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 G PPPPP + PPPPP P P K Sbjct: 758 GSAPPPPPPAPIEGGGGIPPPPP-PMSASPSK 788 Score = 31.5 bits (68), Expect = 1.5 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP F PP P PP G P P PPP P G PP Sbjct: 719 PPPLPAFVAPPPPPPPPPPPPPMANYGAPPPP------PPPPPGSGSAPP 762 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 751 GAGX-PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+G PPPP + PPPPPP P K T Sbjct: 756 GSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTT 790 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 736 PPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 766 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 735 PPPPPPMANYGAPPPPPPPPPGSGSAPPPPP 765 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP 822 G PPPP PPPPPP Sbjct: 745 GAPPPPPPPPPGSGSAPPPPPP 766 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 36.7 bits (81), Expect = 0.041 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 474 APPPPPPPPPLHAFVAPPPPPPPPPPPPPP 503 Score = 35.1 bits (77), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 495 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 525 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 497 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 527 Score = 32.7 bits (71), Expect = 0.67 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP PPPPP P G Sbjct: 510 PPPPPPPPPGSGSAPPPPPPAPIEG 534 Score = 32.3 bits (70), Expect = 0.88 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 G PPPPP + PPPPP P P K Sbjct: 521 GSAPPPPPPAPIEGGGGIPPPPP-PMSASPSK 551 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 751 GAGX-PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+G PPPP + PPPPPP P K T Sbjct: 519 GSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTT 553 Score = 30.7 bits (66), Expect = 2.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP P PP G P P PPP P G PP Sbjct: 482 PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPP------PPPPPGSGSAPP 525 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 499 PPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 498 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 528 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP 822 G PPPP PPPPPP Sbjct: 508 GAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 36.7 bits (81), Expect = 0.041 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 484 APPPPPPPPPLHAFVAPPPPPPPPPPPPPP 513 Score = 35.1 bits (77), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 505 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 535 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 507 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 537 Score = 32.7 bits (71), Expect = 0.67 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP PPPPP P G Sbjct: 520 PPPPPPPPPGSGSAPPPPPPAPIEG 544 Score = 32.3 bits (70), Expect = 0.88 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 G PPPPP + PPPPP P P K Sbjct: 531 GSAPPPPPPAPIEGGGGIPPPPP-PMSASPSK 561 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 751 GAGX-PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+G PPPP + PPPPPP P K T Sbjct: 529 GSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTT 563 Score = 30.7 bits (66), Expect = 2.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP P PP G P P PPP P G PP Sbjct: 492 PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPP------PPPPPGSGSAPP 535 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 509 PPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 508 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 538 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP 822 G PPPP PPPPPP Sbjct: 518 GAPPPPPPPPPGSGSAPPPPPP 539 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 36.7 bits (81), Expect = 0.041 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 474 APPPPPPPPPLHAFVAPPPPPPPPPPPPPP 503 Score = 35.1 bits (77), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 495 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 525 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 497 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 527 Score = 32.7 bits (71), Expect = 0.67 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP PPPPP P G Sbjct: 510 PPPPPPPPPGSGSAPPPPPPAPIEG 534 Score = 32.3 bits (70), Expect = 0.88 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 G PPPPP + PPPPP P P K Sbjct: 521 GSAPPPPPPAPIEGGGGIPPPPP-PMSASPSK 551 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 751 GAGX-PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+G PPPP + PPPPPP P K T Sbjct: 519 GSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTT 553 Score = 30.7 bits (66), Expect = 2.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP P PP G P P PPP P G PP Sbjct: 482 PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPP------PPPPPGSGSAPP 525 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 499 PPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 498 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 528 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP 822 G PPPP PPPPPP Sbjct: 508 GAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 36.7 bits (81), Expect = 0.041 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 632 APPPPPPPPPLHAFVAPPPPPPPPPPPPPP 661 Score = 35.1 bits (77), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 653 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 683 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 655 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 685 Score = 32.7 bits (71), Expect = 0.67 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP PPPPP P G Sbjct: 668 PPPPPPPPPGSGSAPPPPPPAPIEG 692 Score = 32.3 bits (70), Expect = 0.88 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 G PPPPP + PPPPP P P K Sbjct: 679 GSAPPPPPPAPIEGGGGIPPPPP-PMSASPSK 709 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 751 GAGX-PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+G PPPP + PPPPPP P K T Sbjct: 677 GSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTT 711 Score = 30.7 bits (66), Expect = 2.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP P PP G P P PPP P G PP Sbjct: 640 PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPP------PPPPPGSGSAPP 683 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 657 PPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 656 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 686 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP 822 G PPPP PPPPPP Sbjct: 666 GAPPPPPPPPPGSGSAPPPPPP 687 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 36.7 bits (81), Expect = 0.041 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 579 APPPPPPPPPLHAFVAPPPPPPPPPPPPPP 608 Score = 35.1 bits (77), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP P G P Sbjct: 600 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 630 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P G P Sbjct: 602 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 632 Score = 32.7 bits (71), Expect = 0.67 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP PPPPP P G Sbjct: 615 PPPPPPPPPGSGSAPPPPPPAPIEG 639 Score = 32.3 bits (70), Expect = 0.88 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 752 GRXPPPPPXXXXKKNXXXPPPPPXPXXGXPXK 847 G PPPPP + PPPPP P P K Sbjct: 626 GSAPPPPPPAPIEGGGGIPPPPP-PMSASPSK 656 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 751 GAGX-PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G+G PPPP + PPPPPP P K T Sbjct: 624 GSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTT 658 Score = 30.7 bits (66), Expect = 2.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 757 PPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP + PP P PP G P P PPP P G PP Sbjct: 587 PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPP------PPPPPGSGSAPP 630 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 604 PPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P Sbjct: 603 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 633 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPP 822 G PPPP PPPPPP Sbjct: 613 GAPPPPPPPPPGSGSAPPPPPP 634 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 36.7 bits (81), Expect = 0.041 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP + PPPPPPP PP Sbjct: 188 PPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 33.1 bits (72), Expect = 0.50 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPPP PPP Sbjct: 183 GQYPPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 35.9 bits (79), Expect = 0.072 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPPP PPP Sbjct: 463 PEPLSPVKKPAAAPPPPPPPPPPPPP 488 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P K PPPPPPP PPP Sbjct: 463 PEPLSPVKKPAAAPPPPPPPPPPPPPP 489 Score = 32.7 bits (71), Expect = 0.67 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPP PPP Sbjct: 461 PEPEPLSPVKKPAAAPPPPPPPPPPPP 487 Score = 32.7 bits (71), Expect = 0.67 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GAG PPPP PPP PP PPP Sbjct: 647 GAGIPPPPPPLGGA--IAPPPMMPPSLAPPP 675 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P K PPPPP PPP Sbjct: 460 PPEPEPLSPVKKPAAAPPPPPPPPPPP 486 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 478 PPPPPPPPPPPPP 490 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 P P P KK PPPPP P P Sbjct: 461 PEPEPLSPVKKPAAAPPPPPPPPPPPP 487 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 35.9 bits (79), Expect = 0.072 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPPP PPP Sbjct: 645 PEPLSPVKKPAAAPPPPPPPPPPPPP 670 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P K PPPPPPP PPP Sbjct: 645 PEPLSPVKKPAAAPPPPPPPPPPPPPP 671 Score = 32.7 bits (71), Expect = 0.67 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPP PPP Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPP 669 Score = 32.7 bits (71), Expect = 0.67 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GAG PPPP PPP PP PPP Sbjct: 829 GAGIPPPPPLLGGA--IAPPPMMPPSLAPPP 857 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P K PPPPP PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPP 668 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 660 PPPPPPPPPPPPP 672 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 P P P KK PPPPP P P Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPP 669 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 35.9 bits (79), Expect = 0.072 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPPP PPP Sbjct: 645 PEPLSPVKKPAAAPPPPPPPPPPPPP 670 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P K PPPPPPP PPP Sbjct: 645 PEPLSPVKKPAAAPPPPPPPPPPPPPP 671 Score = 32.7 bits (71), Expect = 0.67 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPP PPP Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPP 669 Score = 32.7 bits (71), Expect = 0.67 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GAG PPPP PPP PP PPP Sbjct: 829 GAGIPPPPPPLGGA--IAPPPMMPPSLAPPP 857 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P K PPPPP PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPP 668 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 660 PPPPPPPPPPPPP 672 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 P P P KK PPPPP P P Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPP 669 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 35.9 bits (79), Expect = 0.072 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPPP PPP Sbjct: 645 PEPLSPVKKPAAAPPPPPPPPPPPPP 670 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P K PPPPPPP PPP Sbjct: 645 PEPLSPVKKPAAAPPPPPPPPPPPPPP 671 Score = 32.7 bits (71), Expect = 0.67 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 P P KK PPPPPP PPP Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPP 669 Score = 32.7 bits (71), Expect = 0.67 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GAG PPPP PPP PP PPP Sbjct: 829 GAGIPPPPPPLGGA--IAPPPMMPPSLAPPP 857 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P K PPPPP PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPP 668 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 660 PPPPPPPPPPPPP 672 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 P P P KK PPPPP P P Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPP 669 >BT015290-1|AAT94519.1| 313|Drosophila melanogaster GH12715p protein. Length = 313 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 11 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 59 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 12 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 62 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 63 APQPGFIQPPP 73 >BT003175-1|AAO24930.1| 313|Drosophila melanogaster RH66362p protein. Length = 313 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 11 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 59 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 12 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 62 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 63 APQPGFIQPPP 73 >BT001413-1|AAN71168.1| 324|Drosophila melanogaster GH11283p protein. Length = 324 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 22 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 70 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 23 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 73 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 74 APQPGFIQPPP 84 >AY060346-1|AAL25385.1| 316|Drosophila melanogaster GH26622p protein. Length = 316 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 14 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 62 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 15 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 65 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 66 APQPGFIQPPP 76 >AE013599-1605|AAM68615.1| 316|Drosophila melanogaster CG3798-PF, isoform F protein. Length = 316 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 14 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 62 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 15 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 65 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 66 APQPGFIQPPP 76 >AE013599-1604|AAM68616.2| 324|Drosophila melanogaster CG3798-PE, isoform E protein. Length = 324 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 22 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 70 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 23 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 73 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 74 APQPGFIQPPP 84 >AE013599-1603|AAM68614.1| 324|Drosophila melanogaster CG3798-PD, isoform D protein. Length = 324 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 22 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 70 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 23 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 73 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 74 APQPGFIQPPP 84 >AE013599-1602|AAF58446.1| 324|Drosophila melanogaster CG3798-PC, isoform C protein. Length = 324 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 22 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 70 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 23 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 73 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 74 APQPGFIQPPP 84 >AE013599-1601|AAM68613.1| 313|Drosophila melanogaster CG3798-PB, isoform B protein. Length = 313 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 11 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 59 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 12 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 62 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 63 APQPGFIQPPP 73 >AE013599-1600|AAM68612.1| 313|Drosophila melanogaster CG3798-PA, isoform A protein. Length = 313 Score = 35.5 bits (78), Expect = 0.095 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 769 GGGXPPXXIYFFXPPXGGXPXQKKPPG----XFXGXXPXPXXKXXXPPP 635 GGG PP Y PP GG P Q P G G P P PPP Sbjct: 11 GGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYGQGPPP 59 Score = 31.5 bits (68), Expect = 1.5 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 609 GGXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPX--GGXKKYIXXGGXPPPPXXX 782 GG PP G GG + G P+ P G+ PP GG + Y G PPP Sbjct: 12 GGNPPQGGYGG----YPPQGGYPPQGPPQGY-----PPYAQGGAQPYPQPYGQGPPPGGY 62 Query: 783 XKKKIXXXPPP 815 + PPP Sbjct: 63 APQPGFIQPPP 73 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 34.7 bits (76), Expect = 0.17 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 458 Query: 616 XPP 608 PP Sbjct: 459 GPP 461 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP F PPPP PP PPP Sbjct: 410 PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP 439 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G G PP P PPPPPPP PKK Sbjct: 457 GGGPPPAPGG----PGAPPPPPPPPGLGGAPKK 485 Score = 30.7 bits (66), Expect = 2.7 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFX-----PPXGGXPXQKKP--PGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP F P GG P P P G P P PPP P G Sbjct: 421 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 34.7 bits (76), Expect = 0.17 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G G P PP PPPPPPP PP Sbjct: 220 GTGPPGPPGPPGTTYPQPPPPPPPPPPPPP 249 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 152 PPPPPPPPPPPPP 164 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 153 PPPPPPPPPPPPP 165 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 154 PPPPPPPPPPPPP 166 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 155 PPPPPPPPPPPPP 167 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 156 PPPPPPPPPPPPP 168 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 157 PPPPPPPPPPPPP 169 Score = 30.7 bits (66), Expect = 2.7 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 757 GXPPPPXX-FXKKKXXXPPPPPPPXXXPPP 843 G P PP + + PPPPPPP P P Sbjct: 225 GPPGPPGTTYPQPPPPPPPPPPPPPSYPYP 254 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 34.7 bits (76), Expect = 0.17 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 402 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 461 Query: 616 XPP 608 PP Sbjct: 462 GPP 464 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP F PPPP PP PPP Sbjct: 413 PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP 442 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G G PP P PPPPPPP PKK Sbjct: 460 GGGPPPAPGG----PGAPPPPPPPPGLGGAPKK 488 Score = 30.7 bits (66), Expect = 2.7 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFX-----PPXGGXPXQKKP--PGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP F P GG P P P G P P PPP P G Sbjct: 424 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 481 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 34.7 bits (76), Expect = 0.17 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 545 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 604 Query: 616 XPP 608 PP Sbjct: 605 GPP 607 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP F PPPP PP PPP Sbjct: 556 PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP 585 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G G PP P PPPPPPP PKK Sbjct: 603 GGGPPPAPGG----PGAPPPPPPPPGLGGAPKK 631 Score = 30.7 bits (66), Expect = 2.7 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFX-----PPXGGXPXQKKP--PGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP F P GG P P P G P P PPP P G Sbjct: 567 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 624 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 34.7 bits (76), Expect = 0.17 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 772 PXXFXKKKXXXPPPPPPPXXXPPP 843 P K K PPPPPPP PPP Sbjct: 62 PRHVGKPKAKLPPPPPPPPPPPPP 85 Score = 33.5 bits (73), Expect = 0.38 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPP 843 K K PPPPPPP PPP Sbjct: 69 KAKLPPPPPPPPPPPPPPP 87 Score = 31.9 bits (69), Expect = 1.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 A PPPP PPPPPPP PPP Sbjct: 70 AKLPPPPPP--------PPPPPPPPPPPPP 91 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 34.7 bits (76), Expect = 0.17 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 G G P PP PPPPPPP PP Sbjct: 222 GTGPPGPPGPPGTTYPQPPPPPPPPPPPPP 251 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 154 PPPPPPPPPPPPP 166 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 155 PPPPPPPPPPPPP 167 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 156 PPPPPPPPPPPPP 168 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 157 PPPPPPPPPPPPP 169 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 158 PPPPPPPPPPPPP 170 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 159 PPPPPPPPPPPPP 171 Score = 30.7 bits (66), Expect = 2.7 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 757 GXPPPPXX-FXKKKXXXPPPPPPPXXXPPP 843 G P PP + + PPPPPPP P P Sbjct: 227 GPPGPPGTTYPQPPPPPPPPPPPPPSYPYP 256 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 34.7 bits (76), Expect = 0.17 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 603 Query: 616 XPP 608 PP Sbjct: 604 GPP 606 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP F PPPP PP PPP Sbjct: 555 PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP 584 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G G PP P PPPPPPP PKK Sbjct: 602 GGGPPPAPGG----PGAPPPPPPPPGLGGAPKK 630 Score = 30.7 bits (66), Expect = 2.7 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFX-----PPXGGXPXQKKP--PGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP F P GG P P P G P P PPP P G Sbjct: 566 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 623 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 34.7 bits (76), Expect = 0.17 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 458 Query: 616 XPP 608 PP Sbjct: 459 GPP 461 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP F PPPP PP PPP Sbjct: 410 PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP 439 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G G PP P PPPPPPP PKK Sbjct: 457 GGGPPPAPGG----PGAPPPPPPPPGLGGAPKK 485 Score = 30.7 bits (66), Expect = 2.7 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFX-----PPXGGXPXQKKP--PGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP F P GG P P P G P P PPP P G Sbjct: 421 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 34.7 bits (76), Expect = 0.17 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 458 Query: 616 XPP 608 PP Sbjct: 459 GPP 461 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP F PPPP PP PPP Sbjct: 410 PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP 439 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G G PP P PPPPPPP PKK Sbjct: 457 GGGPPPAPGG----PGAPPPPPPPPGLGGAPKK 485 Score = 30.7 bits (66), Expect = 2.7 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFX-----PPXGGXPXQKKP--PGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP F P GG P P P G P P PPP P G Sbjct: 421 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 34.7 bits (76), Expect = 0.17 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 458 Query: 616 XPP 608 PP Sbjct: 459 GPP 461 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP F PPPP PP PPP Sbjct: 410 PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP 439 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G G PP P PPPPPPP PKK Sbjct: 457 GGGPPPAPGG----PGAPPPPPPPPGLGGAPKK 485 Score = 30.7 bits (66), Expect = 2.7 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFX-----PPXGGXPXQKKP--PGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP F P GG P P P G P P PPP P G Sbjct: 421 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 34.7 bits (76), Expect = 0.17 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPX-----GGXPXQKKPPGXFXGXXPXP---XXKXXXPPPXPXXGG 617 GG G PP PP GG P PP F G P P PP P GG Sbjct: 402 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 461 Query: 616 XPP 608 PP Sbjct: 462 GPP 464 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP F PPPP PP PPP Sbjct: 413 PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP 442 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 G G PP P PPPPPPP PKK Sbjct: 460 GGGPPPAPGG----PGAPPPPPPPPGLGGAPKK 488 Score = 30.7 bits (66), Expect = 2.7 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = -3 Query: 772 GGGGXPPXXIYFFX-----PPXGGXPXQKKP--PGXFXGXXPXPXXKXXXPPPXPXXG 620 GGG PP F P GG P P P G P P PPP P G Sbjct: 424 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 481 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 34.3 bits (75), Expect = 0.22 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPP PP PPP Sbjct: 161 PPPPPAPPTVEPPPPPPPAPPTVEPPP 187 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPP P PPP Sbjct: 185 PPPPPPPAPTKVEPPPPPAPAEVEPPP 211 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 202 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPP PP PPP Sbjct: 162 PPPPAPPTVEPPPPPPPAPPTVEPPPP 188 Score = 30.7 bits (66), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P P Sbjct: 185 PPPPPPPAPTK--VEPPPPPAPAEVEPPPPP 213 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP K PPP PP PP Sbjct: 94 PPPPPRPASPKVEPPPPAPPGVESPP 119 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPP P PPP Sbjct: 186 PPPPPPAPTKVEPPPPPAPAEVEPPPP 212 Score = 29.9 bits (64), Expect = 4.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 131 PPPPHTI-----EPPPPPAPPTLVPPP 152 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPP PP PP Sbjct: 95 PPPPRPASPK--VEPPPPAPPGVESPP 119 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP + P PP P PPP T Sbjct: 107 PPPPAPPGVESPPGPQPPASPRFDPPPPHT 136 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P P Sbjct: 150 PPPPPAPPTIK----PPPPPAPPTVEPPPPP 176 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPP PP PPP Sbjct: 209 PPPPPAPTELEPPPPPAPPKVELPPP 234 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 34.3 bits (75), Expect = 0.22 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPP PP PPP Sbjct: 424 PPPPPAPPTVEPPPPPPPAPPTVEPPP 450 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPP P PPP Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPP 474 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPP PP PPP Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPP 451 Score = 30.7 bits (66), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P P Sbjct: 448 PPPPPPPAPTK--VEPPPPPAPAEVEPPPPP 476 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP K PPP PP PP Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPP 382 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPP P PPP Sbjct: 449 PPPPPPAPTKVEPPPPPAPAEVEPPPP 475 Score = 29.9 bits (64), Expect = 4.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 394 PPPPHTI-----EPPPPPAPPTLVPPP 415 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPP PP PP Sbjct: 358 PPPPRPASPK--VEPPPPAPPGVESPP 382 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP + P PP P PPP T Sbjct: 370 PPPPAPPGVESPPGPQPPASPRFDPPPPHT 399 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P P Sbjct: 413 PPPPPAPPTIK----PPPPPAPPTVEPPPPP 439 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPP PP PPP Sbjct: 472 PPPPPAPTELEPPPPPAPPKVELPPP 497 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 34.3 bits (75), Expect = 0.22 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPP PP PPP Sbjct: 424 PPPPPAPPTVEPPPPPPPAPPTVEPPP 450 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPP P PPP Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPP 474 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPPPP P P P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPP PP PPP Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPP 451 Score = 30.7 bits (66), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P P Sbjct: 448 PPPPPPPAPTK--VEPPPPPAPAEVEPPPPP 476 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP 840 PPPP K PPP PP PP Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPP 382 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPP P PPP Sbjct: 449 PPPPPPAPTKVEPPPPPAPAEVEPPPP 475 Score = 29.9 bits (64), Expect = 4.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP PP PPP Sbjct: 394 PPPPHTI-----EPPPPPAPPTLVPPP 415 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPP PP PP Sbjct: 358 PPPPRPASPK--VEPPPPAPPGVESPP 382 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP + P PP P PPP T Sbjct: 370 PPPPAPPGVESPPGPQPPASPRFDPPPPHT 399 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP K PPPPP P P P Sbjct: 413 PPPPPAPPTIK----PPPPPAPPTVEPPPPP 439 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP + PPP PP PPP Sbjct: 472 PPPPPAPTELEPPPPPAPPKVELPPP 497 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 34.3 bits (75), Expect = 0.22 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPP K PPPPPPP PPP K Sbjct: 370 PPPTK--KVVVYTPPPPPPPVYIPPPTK 395 Score = 33.5 bits (73), Expect = 0.38 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP K PPPPPPP PPP Sbjct: 193 PPPPPPTKKVVYTPPPPPPPPKKVVYTPPP 222 Score = 33.5 bits (73), Expect = 0.38 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPP---XXXPPP 843 PPPP K PPPPPPP PPP Sbjct: 293 PPPPPPTKKVVYTPPPPPPPPKKVVYTPPP 322 Score = 32.7 bits (71), Expect = 0.67 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPP--------PPXXXPPPKK 849 PPP KK PPPPP PP PPPKK Sbjct: 280 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKK 315 Score = 30.3 bits (65), Expect = 3.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 7/35 (20%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPP-------PXXXPPPKK 849 PPP KK PPPPPP P PP KK Sbjct: 167 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKK 201 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 193 PPPPPP--TKKVVYTPPPPPPP 212 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXP 826 PPPPP KK PPPPP P Sbjct: 293 PPPPPP--TKKVVYTPPPPPPP 312 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 33.9 bits (74), Expect = 0.29 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 211 PPPPRPQPTPGYGPPPPPPPPKPQPTP 237 Score = 31.9 bits (69), Expect = 1.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP P PPP P P +P Sbjct: 227 PPPPPKPQPTPGYGPPTPPPGPGPAQPAPQP 257 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPP P P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQP 235 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP PPPPP P P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQP 235 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 751 GAGXPP--PPXXFXKKKXXXPPPPPPPXXXPP 840 G G P P + + PPPPPPP PP Sbjct: 56 GPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPP 87 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 33.9 bits (74), Expect = 0.29 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPPP P P Sbjct: 211 PPPPRPQPTPGYGPPPPPPPPKPQPTP 237 Score = 31.9 bits (69), Expect = 1.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP P PPP P P +P Sbjct: 227 PPPPPKPQPTPGYGPPTPPPGPGPAQPAPQP 257 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPPPPP P P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQP 235 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP PPPPP P P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQP 235 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 751 GAGXPP--PPXXFXKKKXXXPPPPPPPXXXPP 840 G G P P + + PPPPPPP PP Sbjct: 56 GPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPP 87 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 33.9 bits (74), Expect = 0.29 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP PPPPPPP P KK Sbjct: 468 PPPPPPPPPPPPTEPPPPPPPPPEPRVKK 496 Score = 32.3 bits (70), Expect = 0.88 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 465 PPPPPPPPPPPPPPPT 480 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 463 PPPPPPPPPPPPP 475 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PPPP PP PPP PPP+ Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPPPE 491 Score = 30.7 bits (66), Expect = 2.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPP PP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPP 489 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP +K PPPPP P P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSPPAMAP 181 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP +K PPPPP P PP Sbjct: 156 PPPPLEEPEKCPLSPPPPPSPPAMAPP 182 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXP 841 PPPPP +K PPPPP P P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSPPAMAP 181 Score = 33.5 bits (73), Expect = 0.38 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP +K PPPPP P PP Sbjct: 156 PPPPLEEPEKCPLSPPPPPSPPAMAPP 182 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP PPPPPPP P Sbjct: 1279 APVPPPPLPLTPPAAPPPPPPPPPEADDP 1307 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 33.1 bits (72), Expect = 0.50 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP +T Sbjct: 338 PPPPPPPPPPPPPAQT 353 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 335 PPPPPPPPPPPPP 347 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 336 PPPPPPPPPPPPP 348 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 337 PPPPPPPPPPPPP 349 Score = 30.3 bits (65), Expect = 3.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP + P PPP P G Sbjct: 342 PPPPPPPPPAQTSAIPSPPPFPTKG 366 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 33.1 bits (72), Expect = 0.50 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPP 840 A PPPP PPPPPPP P Sbjct: 1339 APVPPPPLPLTPPAAPPPPPPPPPEADDP 1367 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 33.1 bits (72), Expect = 0.50 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP +T Sbjct: 338 PPPPPPPPPPPPPAQT 353 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 335 PPPPPPPPPPPPP 347 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 336 PPPPPPPPPPPPP 348 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 337 PPPPPPPPPPPPP 349 Score = 30.3 bits (65), Expect = 3.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXG 835 PPPPP + P PPP P G Sbjct: 342 PPPPPPPPPAQTSAIPSPPPFPTKG 366 >U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. Length = 452 Score = 32.3 bits (70), Expect = 0.88 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 60 PPPPPPPPPPPPPTAT 75 >AY118390-1|AAM48419.1| 873|Drosophila melanogaster RE39020p protein. Length = 873 Score = 32.3 bits (70), Expect = 0.88 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPP PPPPPPP P P Sbjct: 669 GPPPPHVGHGGHGQPQPPPPPPPHGVPHP 697 >AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p protein. Length = 481 Score = 32.3 bits (70), Expect = 0.88 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 89 PPPPPPPPPPPPPTAT 104 >AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D protein. Length = 481 Score = 32.3 bits (70), Expect = 0.88 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 89 PPPPPPPPPPPPPTAT 104 >AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC, isoform C protein. Length = 481 Score = 32.3 bits (70), Expect = 0.88 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 89 PPPPPPPPPPPPPTAT 104 >AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB, isoform B protein. Length = 481 Score = 32.3 bits (70), Expect = 0.88 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 89 PPPPPPPPPPPPPTAT 104 >AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA, isoform A protein. Length = 481 Score = 32.3 bits (70), Expect = 0.88 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPPPPP PPP T Sbjct: 89 PPPPPPPPPPPPPTAT 104 >AE013599-3085|AAF46639.3| 873|Drosophila melanogaster CG10052-PA protein. Length = 873 Score = 32.3 bits (70), Expect = 0.88 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPP PPPPPPP P P Sbjct: 669 GPPPPHVGHGGHGQPQPPPPPPPHGVPHP 697 >X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.melanogaster 75B mRNAencoding hypothetical 75B protein. ). Length = 1443 Score = 31.9 bits (69), Expect = 1.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PPP++ Sbjct: 273 PPPPPPPPPPPPPQQ 287 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 271 PPPPPPPPPPPPP 283 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 272 PPPPPPPPPPPPP 284 >AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB, isoform B protein. Length = 1412 Score = 31.9 bits (69), Expect = 1.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PPP++ Sbjct: 271 PPPPPPPPPPPPPQQ 285 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 269 PPPPPPPPPPPPP 281 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 270 PPPPPPPPPPPPP 282 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 31.9 bits (69), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP 822 GA PPPP PPPPPP Sbjct: 292 GAAPPPPPPPMINGGALPPPPPPP 315 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP PPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPP 297 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 31.9 bits (69), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPP 822 GA PPPP PPPPPP Sbjct: 292 GAAPPPPPPPMINGGALPPPPPPP 315 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPP PPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPP 297 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 597 PPPPPPMAPSMMPPPPPPCPGAPPPPP 623 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPP K PPP P PPP Sbjct: 582 GAVSPPPAPPMLKAIPPPPPPMAPSMMPPPP 612 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP ++ PPPP PP PPP Sbjct: 87 PPPP----QRPWGPPPPPGPPPPGPPP 109 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPPPP P P Sbjct: 698 PPPPMPASPTASSAAPPPPPPPAPPAP 724 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPP PPPPPPP PP Sbjct: 699 PPPMPASPTASSAAPPPPPPPAPPAPP 725 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PP P PPPPPP PPP Sbjct: 700 PPMPASPTASSAAPPPPPPPAPPAPPP 726 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP + PPPPP P P P Sbjct: 698 PPPPMPASPTASSAAPPPPPPPAPPAPPPPP 728 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 558 PPPPPPMAPSMMPPPPPPCPGAPPPPP 584 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPP K PPP P PPP Sbjct: 543 GAVSPPPAPPMLKAIPPPPPPMAPSMMPPPP 573 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP ++ PPPP PP PPP Sbjct: 117 PPPP----QRPWGPPPPPGPPPPGPPP 139 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 403 PPPPPPMAPSMMPPPPPPCPGAPPPPP 429 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPP K PPP P PPP Sbjct: 388 GAVSPPPAPPMLKAIPPPPPPMAPSMMPPPP 418 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 31.5 bits (68), Expect = 1.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPP+ Sbjct: 642 PPPPPPPPPPPPPQ 655 Score = 30.3 bits (65), Expect = 3.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 808 PPPPPPXXXPPPKKT 852 PPPPPP PPP +T Sbjct: 642 PPPPPPPPPPPPPQT 656 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 31.5 bits (68), Expect = 1.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 805 PPPPPPPXXXPPPK 846 PPPPPPP PPP+ Sbjct: 782 PPPPPPPPPPPPPQ 795 Score = 30.3 bits (65), Expect = 3.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 808 PPPPPPXXXPPPKKT 852 PPPPPP PPP +T Sbjct: 782 PPPPPPPPPPPPPQT 796 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 558 PPPPPPMAPSMMPPPPPPCPGAPPPPP 584 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPP K PPP P PPP Sbjct: 543 GAVSPPPAPPMLKAIPPPPPPMAPSMMPPPP 573 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 597 PPPPPPMAPSMMPPPPPPCPGAPPPPP 623 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPP K PPP P PPP Sbjct: 582 GAVSPPPAPPMLKAIPPPPPPMAPSMMPPPP 612 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP PPPP P PPP Sbjct: 899 PPPPPPMAPSMMPPPPPPCPGAPPPPP 925 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPP K PPP P PPP Sbjct: 884 GAVSPPPAPPMLKAIPPPPPPMAPSMMPPPP 914 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP ++ PPPP PP PPP Sbjct: 117 PPPP----QRPWGPPPPPGPPPPGPPP 139 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP ++ PPPP PP PPP Sbjct: 87 PPPP----QRPWGPPPPPGPPPPGPPP 109 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 31.1 bits (67), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP P P Sbjct: 184 PPPPAAGAPK----PPPPPPPKAAPRP 206 >AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p protein. Length = 217 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 100 PPPPPPPAPAPPP 112 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PP PP PPP Sbjct: 156 PPPPPVVAPKPTYLPPSPPESKYLPPP 182 >AY094826-1|AAM11179.1| 1266|Drosophila melanogaster LD39940p protein. Length = 1266 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 809 PPPPPPPQLHPPP 821 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 31.1 bits (67), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP P P Sbjct: 184 PPPPAAGAPK----PPPPPPPKAAPRP 206 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 31.1 bits (67), Expect = 2.0 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 G G PP PP G PP G P P PPP P PP Sbjct: 431 GHSGPPPP------PPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPP 479 Score = 30.7 bits (66), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP G P P Sbjct: 435 PPPPPPSG---NYGPPPPPPSGNYGPPPPPP 462 Score = 30.7 bits (66), Expect = 2.7 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G PP G P P PPP G PP Sbjct: 450 PPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Score = 30.3 bits (65), Expect = 3.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G PP G P P PPP G PP Sbjct: 460 PPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +G PPPP PPPPP PPP Sbjct: 433 SGPPPPPP---SGNYGPPPPPPSGNYGPPP 459 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP + PPP P P PPP K Sbjct: 129 PPPPKPAPQ---YGPPPQPAPQYGPPPPK 154 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPP PPP Sbjct: 445 GPPPPPP---SGNYGPPPPPPSGNYGPPP 470 >AY051631-1|AAK93055.1| 506|Drosophila melanogaster GH28016p protein. Length = 506 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 49 PPPPPPPQLHPPP 61 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 31.1 bits (67), Expect = 2.0 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -3 Query: 772 GGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 G G PP PP G PP G P P PPP P PP Sbjct: 431 GHSGPPPP------PPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPP 479 Score = 30.7 bits (66), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP N PPPPP G P P Sbjct: 435 PPPPPPSG---NYGPPPPPPSGNYGPPPPPP 462 Score = 30.7 bits (66), Expect = 2.7 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G PP G P P PPP G PP Sbjct: 450 PPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Score = 30.3 bits (65), Expect = 3.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G PP G P P PPP G PP Sbjct: 460 PPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 +G PPPP PPPPP PPP Sbjct: 433 SGPPPPPP---SGNYGPPPPPPSGNYGPPP 459 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKK 849 PPPP + PPP P P PPP K Sbjct: 129 PPPPKPAPQ---YGPPPQPAPQYGPPPPK 154 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 757 GXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP PPPPP PPP Sbjct: 445 GPPPPPP---SGNYGPPPPPPSGNYGPPP 470 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 31.1 bits (67), Expect = 2.0 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 730 PPXGGXPXQKKPPGXFXGXXPXPXXKXXXPPPXPXXGGXPP 608 PP G P + P G P P PPP G PP Sbjct: 555 PPPGPPPPGQPPTGGQQQPPPGPPQSQYGPPPPQNSAGGPP 595 >AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-PA protein. Length = 1493 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 808 PPPPPPXXXPPPKK 849 PPPPPP PPP+K Sbjct: 611 PPPPPPPPVPPPRK 624 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP + PPP PP PPP Sbjct: 53 PPPPSPPCGRPPPGSPPPGPPPPGPPP 79 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 755 RXPPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 R PPPPP + PPP P G P P Sbjct: 50 RPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCP 82 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 31.1 bits (67), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PPPPPPP P P Sbjct: 184 PPPPAAGAPK----PPPPPPPKAAPRP 206 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPP 843 PPPP K PP PP PPP Sbjct: 156 PPPPPVVAPKPTYLPPSPPESKYLPPP 182 >AE013599-2106|AAF58108.2| 1263|Drosophila melanogaster CG30089-PA protein. Length = 1263 Score = 31.1 bits (67), Expect = 2.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 805 PPPPPPPXXXPPP 843 PPPPPPP PPP Sbjct: 806 PPPPPPPQLHPPP 818 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 25.4 bits (53), Expect(2) = 2.5 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 595 PPXXXGGXPPLXVWGGXXXFFXGGG 669 PP PP+ WGG GGG Sbjct: 734 PPPPGTSAPPMPPWGGGAYSGWGGG 758 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPP 825 A PPPP PPPPP Sbjct: 760 APPPPPPCAPPPPALSLSQPPPPP 783 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 25.4 bits (53), Expect(2) = 2.6 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 595 PPXXXGGXPPLXVWGGXXXFFXGGG 669 PP PP+ WGG GGG Sbjct: 364 PPPPGTSAPPMPPWGGGAYSGWGGG 388 Score = 23.8 bits (49), Expect(2) = 2.6 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPP 825 A PPPP PPPPP Sbjct: 390 APPPPPPCAPPPPALSLSQPPPPP 413 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G P P K PPPPPPP P PK T Sbjct: 25 GYDYPQPAPPAPVKSYIPPPPPPPP---PAPKNT 55 Score = 29.9 bits (64), Expect = 4.7 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPP K PPPPPPP P PK T Sbjct: 58 PPPAA--PAKAYIPPPPPPP--PPAPKNT 82 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G P P K PPPPPPP P PK T Sbjct: 25 GYDYPQPAPPAPVKSYIPPPPPPPP---PAPKNT 55 Score = 29.9 bits (64), Expect = 4.7 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPP K PPPPPPP P PK T Sbjct: 58 PPPAA--PAKAYIPPPPPPP--PPAPKNT 82 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 25.4 bits (53), Expect(2) = 2.8 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 595 PPXXXGGXPPLXVWGGXXXFFXGGG 669 PP PP+ WGG GGG Sbjct: 169 PPPPGTSAPPMPPWGGGAYSGWGGG 193 Score = 23.8 bits (49), Expect(2) = 2.8 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPP 825 A PPPP PPPPP Sbjct: 195 APPPPPPCAPPPPALSLSQPPPPP 218 >L14768-1|AAB39774.1| 1429|Drosophila melanogaster expanded protein. Length = 1429 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP-PKK 849 PPPP + ++ PP P P PP P K Sbjct: 1200 PPPPPPYVNRRLKKPPMPAPSEKPPPIPSK 1229 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP + PP P P PPP Sbjct: 1195 GKRLPPPPPPPYVNRRLKKPPMPAPSEKPPP 1225 >EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-peptidase protein. Length = 528 Score = 30.3 bits (65), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 769 PPXXFXKKKXXXPPPPPPPXXXPP 840 PP PPPPPPP PP Sbjct: 218 PPVPTITSSPAPPPPPPPPLPTPP 241 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 30.3 bits (65), Expect = 3.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 F P PP K PPPPPPP PP T Sbjct: 44 FPTPSAPAPPP----KPRPPPPPPPPPTTTRPPTTT 75 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 30.3 bits (65), Expect = 3.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 F P PP K PPPPPPP PP T Sbjct: 44 FPTPSAPAPPP----KPRPPPPPPPPPTTTRPPTTT 75 >AY069068-1|AAL39213.1| 1427|Drosophila melanogaster GH08582p protein. Length = 1427 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP-PKK 849 PPPP + ++ PP P P PP P K Sbjct: 1200 PPPPPPYVNRRLKKPPMPAPSEKPPPIPSK 1229 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP + PP P P PPP Sbjct: 1195 GKRLPPPPPPPYVNRRLKKPPMPAPSEKPPP 1225 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 30.3 bits (65), Expect = 3.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 745 FXGAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 F P PP K PPPPPPP PP T Sbjct: 26 FPTPSAPAPPP----KPRPPPPPPPPPTTTRPPTTT 57 >AE014134-106|AAF51495.1| 1427|Drosophila melanogaster CG4114-PA protein. Length = 1427 Score = 30.3 bits (65), Expect = 3.6 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPP-PKK 849 PPPP + ++ PP P P PP P K Sbjct: 1200 PPPPPPYVNRRLKKPPMPAPSEKPPPIPSK 1229 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 G PPPP + PP P P PPP Sbjct: 1195 GKRLPPPPPPPYVNRRLKKPPMPAPSEKPPP 1225 >AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p protein. Length = 877 Score = 29.9 bits (64), Expect = 4.7 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 612 GXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPPXXXXKK 791 G PP G GGG G P G PP GG PPPP Sbjct: 150 GPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPPYGQYPA 209 Query: 792 KIXXXPP 812 PP Sbjct: 210 MQHWRPP 216 Score = 29.5 bits (63), Expect = 6.2 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = -3 Query: 820 GGGGGXXXIFFXXXXXGGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXP 662 GGGGG + G G PP + P GG P ++P G G P P Sbjct: 157 GGGGGGGHM-------GMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPP 202 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 29.9 bits (64), Expect = 4.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 711 GXPPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPP 818 G PP GG PPPP PPPP Sbjct: 392 GVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 +F G PPPP PPPPP P Sbjct: 402 VFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 433 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 764 PPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP + PPPPP P G P P Sbjct: 372 PPPPTAA---SVGVPPPPPAPPAGVPPAPP 398 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 29.9 bits (64), Expect = 4.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 711 GXPPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPP 818 G PP GG PPPP PPPP Sbjct: 392 GVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 +F G PPPP PPPPP P Sbjct: 402 VFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 433 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 764 PPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP + PPPPP P G P P Sbjct: 372 PPPPTAA---SVGVPPPPPAPPAGVPPAPP 398 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 29.9 bits (64), Expect = 4.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 711 GXPPXGGXKKYIXXGGXPPPPXXXXKKKIXXXPPPP 818 G PP GG PPPP PPPP Sbjct: 508 GVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 543 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 742 IFXGAGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 +F G PPPP PPPPP P Sbjct: 518 VFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 549 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 764 PPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPP + PPPPP P G P P Sbjct: 488 PPPPTAA---SVGVPPPPPAPPAGVPPAPP 514 >AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA, isoform A protein. Length = 2061 Score = 29.9 bits (64), Expect = 4.7 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 612 GXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPPXXXXKK 791 G PP G GGG G P G PP GG PPPP Sbjct: 1334 GPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPPYGQYPA 1393 Query: 792 KIXXXPP 812 PP Sbjct: 1394 MQHWRPP 1400 Score = 29.5 bits (63), Expect = 6.2 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = -3 Query: 820 GGGGGXXXIFFXXXXXGGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXP 662 GGGGG + G G PP + P GG P ++P G G P P Sbjct: 1341 GGGGGGGHM-------GMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPP 1386 >AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB, isoform B protein. Length = 2103 Score = 29.9 bits (64), Expect = 4.7 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 612 GXPPXXGXGGGXXFFXXGXGXXPKKXPGGFFWXGXPPXGGXKKYIXXGGXPPPPXXXXKK 791 G PP G GGG G P G PP GG PPPP Sbjct: 1376 GPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPPYGQYPA 1435 Query: 792 KIXXXPP 812 PP Sbjct: 1436 MQHWRPP 1442 Score = 29.5 bits (63), Expect = 6.2 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = -3 Query: 820 GGGGGXXXIFFXXXXXGGGGXPPXXIYFFXPPXGGXPXQKKPPGXFXGXXPXP 662 GGGGG + G G PP + P GG P ++P G G P P Sbjct: 1383 GGGGGGGHM-------GMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPP 1428 >AE014134-231|AAF51393.1| 80|Drosophila melanogaster CG5011-PA protein. Length = 80 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PPPPP PPP P G P +P Sbjct: 2 PPPPPHHHHNPPPHGPPPHGPPHHGPPHHEP 32 >AE013599-3331|AAM68208.2| 761|Drosophila melanogaster CG13503-PE, isoform E protein. Length = 761 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 787 KKKXXXPPPP-PPPXXXPPP 843 K+K PPPP PPP PPP Sbjct: 8 KQKMAIPPPPGPPPPPGPPP 27 >AE013599-1064|AAM68780.2| 1734|Drosophila melanogaster CG18408-PB, isoform B protein. Length = 1734 Score = 29.9 bits (64), Expect = 4.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 790 KKXXXPPPPPPPXXXPPPKKT 852 +K PPP PPP PPP ++ Sbjct: 146 RKAATPPPAPPPPPPPPPHQS 166 >AB053479-1|BAB62018.1| 1743|Drosophila melanogaster DCAPL2 protein. Length = 1743 Score = 29.9 bits (64), Expect = 4.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 790 KKXXXPPPPPPPXXXPPPKKT 852 +K PPP PPP PPP ++ Sbjct: 146 RKAATPPPAPPPPPPPPPHQS 166 >BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p protein. Length = 337 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPP 843 GA PPPP + P PP P PPP Sbjct: 210 GAYYPPPPPFYPPYYGYPPYYPPYPYPPPPP 240 >BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p protein. Length = 175 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G P P F PPPPPP P P T Sbjct: 41 GYDYPKPEIPFVITSTTEPPPPPPTYLPPKPVPT 74 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP P P P P PPP T Sbjct: 77 PPPPPTTTTTTTTTPAPTPAPTYLPPPPPT 106 >BT016162-1|AAV37047.1| 702|Drosophila melanogaster AT08270p protein. Length = 702 Score = 29.5 bits (63), Expect = 6.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPP--PPPXXXPPPKKT 852 PP K PPPP PPP PP KT Sbjct: 223 PPTGGSPPAKSGAPPPPKGPPPGTPPPQTKT 253 >AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 protein. Length = 359 Score = 29.5 bits (63), Expect = 6.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPP PP PPP+ T Sbjct: 170 PPPPLPPPPPPPPRPT 185 >AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA protein. Length = 359 Score = 29.5 bits (63), Expect = 6.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 805 PPPPPPPXXXPPPKKT 852 PPPP PP PPP+ T Sbjct: 170 PPPPLPPPPPPPPRPT 185 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 29.5 bits (63), Expect = 6.2 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +1 Query: 763 PPPPXXFXKKKXXXP-----PPPPPPXXXPPPKK 849 PPP K P PPPPPP PPP + Sbjct: 208 PPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTR 241 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PP PPPPPPP PP + Sbjct: 300 PPTNKPLPPVTTRLPPPPPPPRTPPPTR 327 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 29.5 bits (63), Expect = 6.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPPPPPXXXPPPK 846 PP PPPPPP PPP+ Sbjct: 291 PPQKYLPPVTTTQAPPPPPPKYLPPPQ 317 >AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA protein. Length = 172 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 751 GAGXPPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 G P P F PPPPPP P P T Sbjct: 38 GYDYPKPEIPFVITSTTEPPPPPPTYLPPKPVPT 71 Score = 29.5 bits (63), Expect = 6.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 763 PPPPXXFXKKKXXXPPPPPPPXXXPPPKKT 852 PPPP P P P P PPP T Sbjct: 74 PPPPPTTTTTTTTTPAPTPAPTYLPPPPPT 103 >AE013599-2521|AAF57825.3| 702|Drosophila melanogaster CG11423-PA protein. Length = 702 Score = 29.5 bits (63), Expect = 6.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 766 PPPXXFXKKKXXXPPPP--PPPXXXPPPKKT 852 PP K PPPP PPP PP KT Sbjct: 223 PPTGGSPPAKSGAPPPPKGPPPGTPPPQTKT 253 >BT021370-1|AAX33518.1| 884|Drosophila melanogaster LP07893p protein. Length = 884 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 711 GXPPXGGXKKY-IXXGGXPPPPXXXXKKKIXXXPPPPP 821 G PP G ++Y PPPP +++ PPPPP Sbjct: 372 GPPPPGAYRRYPYYQHAGPPPPHELYEQQ----PPPPP 405 >BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p protein. Length = 515 Score = 29.1 bits (62), Expect = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPP 843 +K P PPPPP PPP Sbjct: 386 QKSLVAPTPPPPPPPPPPP 404 >BT004503-1|AAO42667.1| 2201|Drosophila melanogaster GH07949p protein. Length = 2201 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 711 GXPPXGGXKKY-IXXGGXPPPPXXXXKKKIXXXPPPPP 821 G PP G ++Y PPPP +++ PPPPP Sbjct: 1117 GPPPPGAYRRYPYYQHAGPPPPHELYEQQ----PPPPP 1150 >AY060485-1|AAL25524.1| 696|Drosophila melanogaster SD09360p protein. Length = 696 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 AG P PP + PPPPPPP P Sbjct: 427 AGPPGPPMG-PPQGYYGPPPPPPPNGPP 453 >AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. Length = 2715 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PP PP N PPPPP G P Sbjct: 597 PPAPPPNQGMNNMATPPPPPQGAAGGGYPMP 627 >AE014298-2950|ABC67193.1| 1456|Drosophila melanogaster CG32529-PD, isoform D protein. Length = 1456 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 711 GXPPXGGXKKY-IXXGGXPPPPXXXXKKKIXXXPPPPP 821 G PP G ++Y PPPP +++ PPPPP Sbjct: 372 GPPPPGAYRRYPYYQHAGPPPPHELYEQQ----PPPPP 405 >AE014298-2949|AAF49024.2| 1280|Drosophila melanogaster CG32529-PC, isoform C protein. Length = 1280 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 711 GXPPXGGXKKY-IXXGGXPPPPXXXXKKKIXXXPPPPP 821 G PP G ++Y PPPP +++ PPPPP Sbjct: 196 GPPPPGAYRRYPYYQHAGPPPPHELYEQQ----PPPPP 229 >AE014298-2947|AAF49026.2| 2529|Drosophila melanogaster CG32529-PA, isoform A protein. Length = 2529 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 711 GXPPXGGXKKY-IXXGGXPPPPXXXXKKKIXXXPPPPP 821 G PP G ++Y PPPP +++ PPPPP Sbjct: 1445 GPPPPGAYRRYPYYQHAGPPPPHELYEQQ----PPPPP 1478 >AE014298-2790|AAF48905.2| 437|Drosophila melanogaster CG7349-PA protein. Length = 437 Score = 29.1 bits (62), Expect = 8.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PP K Sbjct: 167 PPPPPPPAKSAPPVK 181 >AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-PA protein. Length = 2030 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 754 AGXPPPPXXFXKKKXXXPPPPPPPXXXP 837 AG P PP + PPPPPPP P Sbjct: 1761 AGPPGPPMG-PPQGYYGPPPPPPPNGPP 1787 >AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-PA, isoform A protein. Length = 858 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PPP+K Sbjct: 524 PPPPPPP---PPPRK 535 >AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-PB, isoform B protein. Length = 968 Score = 29.1 bits (62), Expect = 8.2 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 805 PPPPPPPXXXPPPKK 849 PPPPPPP PPP+K Sbjct: 634 PPPPPPP---PPPRK 645 >AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-PC, isoform C protein. Length = 515 Score = 29.1 bits (62), Expect = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPP 843 +K P PPPPP PPP Sbjct: 386 QKSLVAPTPPPPPPPPPPP 404 >AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-PB, isoform B protein. Length = 515 Score = 29.1 bits (62), Expect = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPP 843 +K P PPPPP PPP Sbjct: 386 QKSLVAPTPPPPPPPPPPP 404 >AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-PA, isoform A protein. Length = 515 Score = 29.1 bits (62), Expect = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 787 KKKXXXPPPPPPPXXXPPP 843 +K P PPPPP PPP Sbjct: 386 QKSLVAPTPPPPPPPPPPP 404 >AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB, isoform B protein. Length = 2716 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PP PP N PPPPP G P Sbjct: 598 PPAPPPNQGMNNMATPPPPPQGAAGGGYPMP 628 >AE014297-2397|AAS65166.1| 2556|Drosophila melanogaster CG7467-PC, isoform C protein. Length = 2556 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PP PP N PPPPP G P Sbjct: 598 PPAPPPNQGMNNMATPPPPPQGAAGGGYPMP 628 >AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA, isoform A protein. Length = 2703 Score = 29.1 bits (62), Expect = 8.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 761 PPPPPXXXXKKNXXXPPPPPXPXXGXPXKKP 853 PP PP N PPPPP G P Sbjct: 598 PPAPPPNQGMNNMATPPPPPQGAAGGGYPMP 628 >AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-PA protein. Length = 239 Score = 29.1 bits (62), Expect = 8.2 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +1 Query: 763 PPPPXXFX-----KKKXXXPPPPPP-PXXXPPPK 846 PPPP KK PPP PP P PPPK Sbjct: 45 PPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPPK 78 >BT029293-1|ABK30930.1| 681|Drosophila melanogaster RT01152p protein. Length = 681 Score = 25.4 bits (53), Expect(2) = 9.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 504 PPPPPPPPPLP 514 Score = 21.8 bits (44), Expect(2) = 9.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 781 FXKKKXXXPPPPPP 822 F + PPPPPP Sbjct: 499 FANQTPPPPPPPPP 512 >BT029292-1|ABK30929.1| 681|Drosophila melanogaster RT01151p protein. Length = 681 Score = 25.4 bits (53), Expect(2) = 9.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 504 PPPPPPPPPLP 514 Score = 21.8 bits (44), Expect(2) = 9.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 781 FXKKKXXXPPPPPP 822 F + PPPPPP Sbjct: 499 FANQTPPPPPPPPP 512 >BT029291-1|ABK30928.1| 681|Drosophila melanogaster RT01150p protein. Length = 681 Score = 25.4 bits (53), Expect(2) = 9.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 504 PPPPPPPPPLP 514 Score = 21.8 bits (44), Expect(2) = 9.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 781 FXKKKXXXPPPPPP 822 F + PPPPPP Sbjct: 499 FANQTPPPPPPPPP 512 >AE014297-3156|AAF55998.2| 681|Drosophila melanogaster CG31160-PA protein. Length = 681 Score = 25.4 bits (53), Expect(2) = 9.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 504 PPPPPPPPPLP 514 Score = 21.8 bits (44), Expect(2) = 9.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 781 FXKKKXXXPPPPPP 822 F + PPPPPP Sbjct: 499 FANQTPPPPPPPPP 512 >BT030107-1|ABN49246.1| 635|Drosophila melanogaster GH13974p protein. Length = 635 Score = 25.4 bits (53), Expect(2) = 9.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 501 PPPPPPPRRDP 511 Score = 21.8 bits (44), Expect(2) = 9.4 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 781 FXKKKXXXPPPPPP 822 F + PPPPPP Sbjct: 494 FLQMSNRPPPPPPP 507 >BT010123-1|AAQ22592.1| 489|Drosophila melanogaster AT19280p protein. Length = 489 Score = 25.4 bits (53), Expect(2) = 9.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 805 PPPPPPPXXXP 837 PPPPPPP P Sbjct: 307 PPPPPPPPPLP 317 Score = 21.8 bits (44), Expect(2) = 9.6 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 781 FXKKKXXXPPPPPP 822 F + PPPPPP Sbjct: 302 FANQTPPPPPPPPP 315 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,295,887 Number of Sequences: 53049 Number of extensions: 919732 Number of successful extensions: 14563 Number of sequences better than 10.0: 153 Number of HSP's better than 10.0 without gapping: 2438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8658 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4147514904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -