BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D24 (847 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 3.0 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 4.0 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 4.0 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 5.3 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 22 7.0 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = -1 Query: 484 QRACGFCPKPNLRFPFQWCSDHGHSCW 404 Q C + PN C+D SCW Sbjct: 15 QLECNWSSGPNATLQSSACTDDLSSCW 41 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.6 bits (46), Expect = 4.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 409 NYARGHYTIGKEIVDLVLDRIRKLADQCTG 498 +YAR G IVD+ LD R L CTG Sbjct: 392 SYARAKGLGGIAIVDITLDDFRGL---CTG 418 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 22.6 bits (46), Expect = 4.0 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +2 Query: 566 WS-VSPLTTARS--LN-WSSPSTPRPQVSTAXRRALQLYPHHPHNPXSTLTVLSW 718 WS V TT S +N WS S+P P + + P+ + P + LT L++ Sbjct: 307 WSTVQTPTTVMSPTINCWSLTSSPPPPYQISAQPTPSQSPNQIYQPVTNLTNLTY 361 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 575 SPLTTARSLNWSSPSTPRPQVSTAXR 652 +PL N +S S P P +ST R Sbjct: 384 NPLINILYANMNSYSVPEPTISTTPR 409 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 296 RGTCLPAPVSLKKVLKES 243 RGTC P LKK L ++ Sbjct: 53 RGTCSPDGEELKKALPDA 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,697 Number of Sequences: 336 Number of extensions: 4252 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -