BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D21 (860 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 3.6 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 23 3.6 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 8.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 8.4 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.0 bits (47), Expect = 3.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 291 TFQQQKHLTKHYPVRKQRVLHLRQFQEQLRI 383 T + Q T H + K R HLR E+L++ Sbjct: 43 TKKSQGSRTTHNELEKNRRAHLRNCLEKLKV 73 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -1 Query: 272 DLIQAMSPHARHVLFQQLDLQFHISHS 192 DLI+A+ RH +++ + H+SH+ Sbjct: 72 DLIKAIIDSDRHSTTREIAEKLHVSHT 98 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 8.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 60 TNSQIYSLSPI*SGHLHYCNSKTYCKELAG 149 TN+ YS P+ S L+Y N+K + K G Sbjct: 263 TNNLYYS--PLSSRSLYYVNTKPFMKSEYG 290 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +3 Query: 54 QGTNSQIYSLSPI*SGHLHYCNSKTYCKEL 143 Q SQIY + GH + C T +++ Sbjct: 1052 QAEASQIYDMLVYEGGHFYVCGDCTMAEDV 1081 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,793 Number of Sequences: 438 Number of extensions: 4104 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -