BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D20 (865 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 91 4e-20 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 2.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 5.2 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 91.1 bits (216), Expect = 4e-20 Identities = 48/76 (63%), Positives = 57/76 (75%) Frame = +1 Query: 514 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGS*QKGYWRTKCTYL*P 693 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYG K + + Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGL-DKNLKGERNVLIFD 59 Query: 694 RGGVPSTLSILTIEDG 741 GG +SILTI++G Sbjct: 60 LGGGTFDVSILTIDEG 75 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.4 bits (53), Expect = 2.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 630 CDCLRVLTKRVLENEMYLSLTSGGGTFDVVHPYH 731 C+C VL + L + + + G TFD HP+H Sbjct: 837 CECSHVL-QIPLHATVEMVMIDEGFTFDANHPFH 869 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 5.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 141 QEYAVPRSIPTAGAFA 94 Q+YA PR++ +AG FA Sbjct: 1244 QDYAPPRALMSAGGFA 1259 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 887,204 Number of Sequences: 2352 Number of extensions: 18410 Number of successful extensions: 35 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92199573 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -