BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D20 (865 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.3 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 6.3 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 6.3 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 732 DGKDGQRRRYPP-PRSKISTFRSPVPFLSRPVS 637 DG R PP P +I S +P L RP+S Sbjct: 628 DGTQETEERLPPLPPKRIRKMPS-MPLLPRPIS 659 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 6.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 553 QRQATKDAGTISGLNVLRIINEPTAAAIAYG 645 Q +A K A + N II+EPT YG Sbjct: 353 QAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 232,522 Number of Sequences: 438 Number of extensions: 5250 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27916710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -