BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D12 (858 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 28 0.13 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 4.8 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 8.3 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 27.9 bits (59), Expect = 0.13 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 742 HPLTGDLNHLVSLTMSGCHHLPL 810 HPLTGDL+ SG +H+P+ Sbjct: 103 HPLTGDLSPAAVSYTSGFYHIPV 125 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 4.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 669 FQLAGELRESHCM 631 F G +RESHCM Sbjct: 68 FGCCGAIRESHCM 80 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 8.3 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 569 QNHEHILSSPLAQSIRHCRRTIQCDSLSSPAS*KHRRNILHRQRG 703 Q H+ +++SPL+Q + + +L SP R+ R+RG Sbjct: 230 QQHQGVVTSPLSQQQQAAPQGAASANLPSPLY-PWMRSQFERKRG 273 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 227,588 Number of Sequences: 438 Number of extensions: 4620 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27673956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -