BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D09 (858 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0052 + 7788655-7789850,7789921-7790011 29 3.6 10_08_0818 + 20801061-20801298,20801409-20801509,20801600-208018... 29 3.6 02_05_0015 - 24992253-24993993,24995331-24995695 29 4.7 08_02_1075 + 24149570-24149833,24150008-24150307 29 6.3 >11_02_0052 + 7788655-7789850,7789921-7790011 Length = 428 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 632 VKQNFEFVQCVTFV-EHFVSRHLDEH 558 +K + ++ CV F EHFV+R++D H Sbjct: 339 IKNDVDYYSCVCFGNEHFVARYIDRH 364 >10_08_0818 + 20801061-20801298,20801409-20801509,20801600-20801817, 20802461-20802824 Length = 306 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Frame = +1 Query: 376 PGCACSPGL---LQSLYAHPSAARPNPGH 453 PG AC P L L L HPS A+P+PG+ Sbjct: 10 PGSACIPLLILLLLLLLLHPSEAQPSPGY 38 >02_05_0015 - 24992253-24993993,24995331-24995695 Length = 701 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 213 AKYVVGDHRNGDAKIELDANKRQFTGMTREEVLKYADDPFWVN 341 AK V+ + GD + K T + RE V YADDP N Sbjct: 531 AKKVLTMNPTGDLSSARFSEKNLLTAIDREAVFSYADDPCSAN 573 >08_02_1075 + 24149570-24149833,24150008-24150307 Length = 187 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 125 LRFAEVRFGRPEFRNQLVND 66 LRFA V+FG PEF +ND Sbjct: 60 LRFAIVKFGHPEFAGLALND 79 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,764,028 Number of Sequences: 37544 Number of extensions: 445528 Number of successful extensions: 1308 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1308 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2397465936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -