BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D09 (858 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071357-1|AAL48979.1| 565|Drosophila melanogaster RE39378p pro... 136 4e-32 AE014297-677|AAF54170.1| 565|Drosophila melanogaster CG2791-PA ... 136 4e-32 V00204-1|CAA23491.1| 522|Drosophila melanogaster protein H prot... 55 1e-07 AY070626-1|AAL48097.2| 582|Drosophila melanogaster RE72980p pro... 55 1e-07 AE013599-658|AAF59084.2| 599|Drosophila melanogaster CG11669-PA... 55 1e-07 AE013599-651|AAF59089.3| 577|Drosophila melanogaster CG8696-PA ... 55 1e-07 BT022844-1|AAY55260.1| 499|Drosophila melanogaster IP12989p pro... 53 6e-07 BT022819-1|AAY55235.1| 499|Drosophila melanogaster IP13189p pro... 53 6e-07 AE014134-2106|AAF53127.1| 584|Drosophila melanogaster CG14934-P... 53 6e-07 AY119031-1|AAM50891.1| 503|Drosophila melanogaster LP05695p pro... 48 1e-05 AE013599-659|AAF59083.2| 588|Drosophila melanogaster CG8690-PA ... 48 1e-05 V00204-3|CAA23493.1| 505|Drosophila melanogaster protein L prot... 48 2e-05 AY119654-1|AAM50308.1| 574|Drosophila melanogaster RE74287p pro... 48 2e-05 AY071351-1|AAL48973.1| 564|Drosophila melanogaster RE38869p pro... 48 2e-05 AE014134-2108|AAN10789.1| 564|Drosophila melanogaster CG14935-P... 48 2e-05 AE014134-2107|AAF53128.2| 583|Drosophila melanogaster CG14935-P... 48 2e-05 AE013599-653|AAF59087.2| 574|Drosophila melanogaster CG8695-PA ... 48 2e-05 V00204-2|CAA23492.1| 508|Drosophila melanogaster protein D prot... 47 3e-05 AY071566-1|AAL49188.1| 567|Drosophila melanogaster RE63163p pro... 47 3e-05 AE013599-652|AAF59088.1| 567|Drosophila melanogaster CG8694-PA ... 47 3e-05 AE013599-654|AAF59086.1| 579|Drosophila melanogaster CG8693-PA ... 46 5e-05 BT022825-1|AAY55241.1| 551|Drosophila melanogaster IP13260p pro... 44 4e-04 BT022789-1|AAY55205.1| 484|Drosophila melanogaster IP13460p pro... 44 4e-04 AE013599-657|AAS64893.1| 580|Drosophila melanogaster CG30360-PB... 44 4e-04 AE013599-656|AAM68846.1| 606|Drosophila melanogaster CG30360-PA... 44 4e-04 BT016068-1|AAV36953.1| 630|Drosophila melanogaster LP11544p pro... 39 0.010 AY069158-1|AAL39303.1| 534|Drosophila melanogaster GH18222p pro... 39 0.010 AE013599-655|AAF59085.2| 630|Drosophila melanogaster CG30359-PA... 39 0.010 J03251-1|AAA28714.1| 846|Drosophila melanogaster myospheroid pr... 31 2.0 AY113499-1|AAM29504.1| 846|Drosophila melanogaster RE55238p pro... 31 2.0 AE014298-1112|AAF46313.2| 846|Drosophila melanogaster CG1560-PA... 31 2.0 AE014296-2343|AAF49771.3| 2294|Drosophila melanogaster CG32133-P... 31 2.7 BT003171-1|AAO24926.1| 443|Drosophila melanogaster SD07604p pro... 30 3.5 BT001477-1|AAN71232.1| 443|Drosophila melanogaster LD21345p pro... 30 3.5 AL023893-1|CAA19655.1| 485|Drosophila melanogaster EG:132E8.1 p... 30 3.5 AE014298-190|AAS65244.1| 443|Drosophila melanogaster CG3056-PB,... 30 3.5 AE014298-189|AAF45613.1| 485|Drosophila melanogaster CG3056-PA,... 30 3.5 M16152-1|AAB59220.1| 2703|Drosophila melanogaster Notch growth f... 30 4.7 K03508-1|AAA28725.1| 2703|Drosophila melanogaster developmental ... 30 4.7 BT023499-1|AAY84899.1| 1400|Drosophila melanogaster LD34134p pro... 30 4.7 AY795937-1|AAY27534.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795936-1|AAY27530.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795935-1|AAY27526.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795934-1|AAY27522.1| 913|Drosophila melanogaster notch protein. 30 4.7 AY795933-1|AAY27518.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795932-1|AAY27514.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795931-1|AAY27510.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795930-1|AAY27506.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795929-1|AAY27502.1| 912|Drosophila melanogaster notch protein. 30 4.7 AY795928-1|AAY27498.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795927-1|AAY27494.1| 912|Drosophila melanogaster notch protein. 30 4.7 AY795926-1|AAY27490.1| 916|Drosophila melanogaster notch protein. 30 4.7 AY795925-1|AAY27486.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795924-1|AAY27482.1| 913|Drosophila melanogaster notch protein. 30 4.7 AY795923-1|AAY27478.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795922-1|AAY27474.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795921-1|AAY27470.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795920-1|AAY27466.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795919-1|AAY27462.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795918-1|AAY27458.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795917-1|AAY27454.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795916-1|AAY27450.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795915-1|AAY27446.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795914-1|AAY27442.1| 911|Drosophila melanogaster notch protein. 30 4.7 AY795913-1|AAY27438.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795912-1|AAY27434.1| 910|Drosophila melanogaster notch protein. 30 4.7 AY795911-1|AAY27429.1| 911|Drosophila melanogaster notch protein. 30 4.7 AL035436-2|CAB37610.1| 2704|Drosophila melanogaster EG:140G11.1,... 30 4.7 AE014298-493|AAF45848.2| 2703|Drosophila melanogaster CG3936-PA ... 30 4.7 AE014298-591|AAF45913.2| 942|Drosophila melanogaster CG32778-PA... 29 6.2 >AY071357-1|AAL48979.1| 565|Drosophila melanogaster RE39378p protein. Length = 565 Score = 136 bits (329), Expect = 4e-32 Identities = 73/188 (38%), Positives = 101/188 (53%), Gaps = 6/188 (3%) Frame = +3 Query: 210 DAKYVVGDHRNGDAKIEL---DANKRQFTGMTREEVLKYADDPFWVNLRWSLFVLFWVAW 380 + K++ GDH+NGDAKI++ + K FTGM++EE++KYA+DPFWV LRW FV FW W Sbjct: 33 EVKFIKGDHQNGDAKIDIGTVNGGKPAFTGMSKEELMKYANDPFWVRLRWIFFVCFWAIW 92 Query: 381 LCMLAGAIAVIVRAPKCGPPEPRTWYELGPLVGLDLVDAVEPXXXXXXXXXXKTFKVQGV 560 + ML GAI +I+ APKC P+P WY+ GP V+ P K G Sbjct: 93 VGMLVGAILIIIGAPKCAAPQPLPWYKRGPHAKFASVETCRP----EDVQVAKKLVSAGA 148 Query: 561 FVQVP---TYEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTX 731 ++P TY+V K + ++ K L RVI+DL PNY N + VQ + Sbjct: 149 IYELPAALTYDV-KKPEVEEKIKHLVALYQGSDTRVILDLTPNYAAKN-SQLVQDAIANP 206 Query: 732 PYTDYFIW 755 F+W Sbjct: 207 EKRSAFVW 214 >AE014297-677|AAF54170.1| 565|Drosophila melanogaster CG2791-PA protein. Length = 565 Score = 136 bits (329), Expect = 4e-32 Identities = 73/188 (38%), Positives = 101/188 (53%), Gaps = 6/188 (3%) Frame = +3 Query: 210 DAKYVVGDHRNGDAKIEL---DANKRQFTGMTREEVLKYADDPFWVNLRWSLFVLFWVAW 380 + K++ GDH+NGDAKI++ + K FTGM++EE++KYA+DPFWV LRW FV FW W Sbjct: 33 EVKFIKGDHQNGDAKIDIGTVNGGKPAFTGMSKEELMKYANDPFWVRLRWIFFVCFWAIW 92 Query: 381 LCMLAGAIAVIVRAPKCGPPEPRTWYELGPLVGLDLVDAVEPXXXXXXXXXXKTFKVQGV 560 + ML GAI +I+ APKC P+P WY+ GP V+ P K G Sbjct: 93 VGMLVGAILIIIGAPKCAAPQPLPWYKRGPHAKFASVETCRP----EDVQVAKKLVSAGA 148 Query: 561 FVQVP---TYEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTX 731 ++P TY+V K + ++ K L RVI+DL PNY N + VQ + Sbjct: 149 IYELPAALTYDV-KKPEVEEKIKHLVALYQGSDTRVILDLTPNYAAKN-SQLVQDAIANP 206 Query: 732 PYTDYFIW 755 F+W Sbjct: 207 EKRSAFVW 214 >V00204-1|CAA23491.1| 522|Drosophila melanogaster protein H protein. Length = 522 Score = 55.2 bits (127), Expect = 1e-07 Identities = 19/59 (32%), Positives = 39/59 (66%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 Y++ + T+++F+ + K ++GI++I+D +PN+ T + WF +S +S Y D++IW Sbjct: 86 YQIHPEYGTMEDFERMIAKAKEVGIKIILDFVPNHSSTENEWFTKSVDSDPVYKDFYIW 144 >AY070626-1|AAL48097.2| 582|Drosophila melanogaster RE72980p protein. Length = 582 Score = 55.2 bits (127), Expect = 1e-07 Identities = 19/59 (32%), Positives = 39/59 (66%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 Y++ + T+++F+ + K ++GI++I+D +PN+ T + WF +S +S Y D++IW Sbjct: 91 YQIHPEYGTMEDFERMIAKAKEVGIKIILDFVPNHSSTENEWFTKSVDSDPVYKDFYIW 149 >AE013599-658|AAF59084.2| 599|Drosophila melanogaster CG11669-PA protein. Length = 599 Score = 55.2 bits (127), Expect = 1e-07 Identities = 18/59 (30%), Positives = 38/59 (64%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 +++ + TLD+F+ L + ++ +++I+D +PN+ ++WFV+S N Y DY++W Sbjct: 102 FDIQPEYGTLDDFRALIKRANELDLKIILDFVPNHSSDENSWFVKSVNREKGYEDYYVW 160 >AE013599-651|AAF59089.3| 577|Drosophila melanogaster CG8696-PA protein. Length = 577 Score = 55.2 bits (127), Expect = 1e-07 Identities = 19/59 (32%), Positives = 39/59 (66%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 Y++ + T+++F+ + K ++GI++I+D +PN+ T + WF +S +S Y D++IW Sbjct: 86 YQIHPEYGTMEDFERMIAKAKEVGIKIILDFVPNHSSTENEWFTKSVDSDPVYKDFYIW 144 >BT022844-1|AAY55260.1| 499|Drosophila melanogaster IP12989p protein. Length = 499 Score = 52.8 bits (121), Expect = 6e-07 Identities = 20/57 (35%), Positives = 34/57 (59%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIWTXEHLL 773 TL++F L K ++G++VI+D +PN+ H WF++S Y D+++W LL Sbjct: 20 TLEDFDALIAKANELGVKVILDFVPNHSSNKHPWFIKSVAREPGYEDFYVWEDGILL 76 >BT022819-1|AAY55235.1| 499|Drosophila melanogaster IP13189p protein. Length = 499 Score = 52.8 bits (121), Expect = 6e-07 Identities = 20/57 (35%), Positives = 34/57 (59%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIWTXEHLL 773 TL++F L K ++G++VI+D +PN+ H WF++S Y D+++W LL Sbjct: 20 TLEDFDALIAKANELGVKVILDFVPNHSSNKHPWFIKSVAREPGYEDFYVWEDGILL 76 >AE014134-2106|AAF53127.1| 584|Drosophila melanogaster CG14934-PA protein. Length = 584 Score = 52.8 bits (121), Expect = 6e-07 Identities = 20/57 (35%), Positives = 34/57 (59%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIWTXEHLL 773 TL++F L K ++G++VI+D +PN+ H WF++S Y D+++W LL Sbjct: 105 TLEDFDALIAKANELGVKVILDFVPNHSSNKHPWFIKSVAREPGYEDFYVWEDGILL 161 >AY119031-1|AAM50891.1| 503|Drosophila melanogaster LP05695p protein. Length = 503 Score = 48.4 bits (110), Expect = 1e-05 Identities = 14/59 (23%), Positives = 35/59 (59%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 +++ + TL++F+ L + ++ +++++D +PN+ WF++S Y DY++W Sbjct: 12 FDIQPEYGTLEDFRTLIKRAKELDLKIVLDFVPNHSSNESEWFLKSVKREKGYEDYYVW 70 >AE013599-659|AAF59083.2| 588|Drosophila melanogaster CG8690-PA protein. Length = 588 Score = 48.4 bits (110), Expect = 1e-05 Identities = 14/59 (23%), Positives = 35/59 (59%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 +++ + TL++F+ L + ++ +++++D +PN+ WF++S Y DY++W Sbjct: 97 FDIQPEYGTLEDFRTLIKRAKELDLKIVLDFVPNHSSNESEWFLKSVKREKGYEDYYVW 155 >V00204-3|CAA23493.1| 505|Drosophila melanogaster protein L protein. Length = 505 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 9/90 (10%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIWTXEHLLXGF 782 T+++F+ L + ++ I++I+D +PN+ WF++S Y D+++W ++ G Sbjct: 95 TMEDFEALLARAKELDIKIILDFVPNHTSDECDWFIRSAAGEEEYKDFYVWPTGKVVNGI 154 Query: 783 K---NXHASVY------XXXKRXMXYLHQF 845 + SV+ +R YLHQF Sbjct: 155 RQPPTNWVSVFRGSMWTWNEERQAYYLHQF 184 >AY119654-1|AAM50308.1| 574|Drosophila melanogaster RE74287p protein. Length = 574 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 9/90 (10%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIWTXEHLLXGF 782 T+++F+ L + ++ I++I+D +PN+ WF++S Y D+++W ++ G Sbjct: 95 TMEDFEALLARAKELDIKIILDFVPNHTSDECDWFIRSAAGEEEYKDFYVWHTGKVVNGI 154 Query: 783 K---NXHASVY------XXXKRXMXYLHQF 845 + SV+ +R YLHQF Sbjct: 155 RQPPTNWVSVFRGSMWTWNEQRQAYYLHQF 184 >AY071351-1|AAL48973.1| 564|Drosophila melanogaster RE38869p protein. Length = 564 Score = 47.6 bits (108), Expect = 2e-05 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 T+ +F+ L + ++GI+V++D +PN+ H WF +S Y D+++W Sbjct: 87 TMQDFEELIDTAFELGIKVVLDFVPNHSSDQHEWFKKSAAREPGYEDFYVW 137 >AE014134-2108|AAN10789.1| 564|Drosophila melanogaster CG14935-PA, isoform A protein. Length = 564 Score = 47.6 bits (108), Expect = 2e-05 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 T+ +F+ L + ++GI+V++D +PN+ H WF +S Y D+++W Sbjct: 87 TMQDFEELIDTAFELGIKVVLDFVPNHSSDQHEWFKKSAAREPGYEDFYVW 137 >AE014134-2107|AAF53128.2| 583|Drosophila melanogaster CG14935-PB, isoform B protein. Length = 583 Score = 47.6 bits (108), Expect = 2e-05 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 T+ +F+ L + ++GI+V++D +PN+ H WF +S Y D+++W Sbjct: 106 TMQDFEELIDTAFELGIKVVLDFVPNHSSDQHEWFKKSAAREPGYEDFYVW 156 >AE013599-653|AAF59087.2| 574|Drosophila melanogaster CG8695-PA protein. Length = 574 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 9/90 (10%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIWTXEHLLXGF 782 T+++F+ L + ++ I++I+D +PN+ WF++S Y D+++W ++ G Sbjct: 95 TMEDFEALLARAKELDIKIILDFVPNHTSDECDWFIRSAAGEEEYKDFYVWHTGKVVNGI 154 Query: 783 K---NXHASVY------XXXKRXMXYLHQF 845 + SV+ +R YLHQF Sbjct: 155 RQPPTNWVSVFRGSMWTWNEQRQAYYLHQF 184 >V00204-2|CAA23492.1| 508|Drosophila melanogaster protein D protein. Length = 508 Score = 47.2 bits (107), Expect = 3e-05 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 TL++F L + +G+++I+D +PN+ + WF +S N Y D+++W Sbjct: 99 TLEDFDDLIVEAKSLGVKIILDFVPNHSSDENVWFEKSVNREDGYDDFYVW 149 >AY071566-1|AAL49188.1| 567|Drosophila melanogaster RE63163p protein. Length = 567 Score = 47.2 bits (107), Expect = 3e-05 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 TL++F L + +G+++I+D +PN+ + WF +S N Y D+++W Sbjct: 99 TLEDFDDLIVEAKSLGVKIILDFVPNHSSDENVWFEKSVNREDGYDDFYVW 149 >AE013599-652|AAF59088.1| 567|Drosophila melanogaster CG8694-PA protein. Length = 567 Score = 47.2 bits (107), Expect = 3e-05 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 TL++F L + +G+++I+D +PN+ + WF +S N Y D+++W Sbjct: 99 TLEDFDDLIVEAKSLGVKIILDFVPNHSSDENVWFEKSVNREDGYDDFYVW 149 >AE013599-654|AAF59086.1| 579|Drosophila melanogaster CG8693-PA protein. Length = 579 Score = 46.4 bits (105), Expect = 5e-05 Identities = 14/51 (27%), Positives = 33/51 (64%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 T+++F+ + ++ ++G+++I+D +PN+ WF++S Y DY++W Sbjct: 96 TMEDFENMVSRAKELGVKIILDFVPNHSSDECDWFLRSAAGEEEYKDYYMW 146 >BT022825-1|AAY55241.1| 551|Drosophila melanogaster IP13260p protein. Length = 551 Score = 43.6 bits (98), Expect = 4e-04 Identities = 17/59 (28%), Positives = 32/59 (54%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 +++ + TL +F L + K I++I+D +PN+ + WF +S Y DY++W Sbjct: 57 FDIQPEYGTLADFDELIAEAKKRNIKIILDFVPNHSSDENVWFQKSVKREKGYEDYYMW 115 >BT022789-1|AAY55205.1| 484|Drosophila melanogaster IP13460p protein. Length = 484 Score = 43.6 bits (98), Expect = 4e-04 Identities = 17/59 (28%), Positives = 32/59 (54%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 +++ + TL +F L + K I++I+D +PN+ + WF +S Y DY++W Sbjct: 62 FDIQPEYGTLADFDELIAEAKKRNIKIILDFVPNHSSDENVWFQKSVKREKGYEDYYMW 120 >AE013599-657|AAS64893.1| 580|Drosophila melanogaster CG30360-PB, isoform B protein. Length = 580 Score = 43.6 bits (98), Expect = 4e-04 Identities = 17/59 (28%), Positives = 32/59 (54%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 +++ + TL +F L + K I++I+D +PN+ + WF +S Y DY++W Sbjct: 107 FDIQPEYGTLADFDELIAEAKKRNIKIILDFVPNHSSDENVWFQKSVKREKGYEDYYMW 165 >AE013599-656|AAM68846.1| 606|Drosophila melanogaster CG30360-PA, isoform A protein. Length = 606 Score = 43.6 bits (98), Expect = 4e-04 Identities = 17/59 (28%), Positives = 32/59 (54%) Frame = +3 Query: 579 YEVLDKRDTLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 +++ + TL +F L + K I++I+D +PN+ + WF +S Y DY++W Sbjct: 107 FDIQPEYGTLADFDELIAEAKKRNIKIILDFVPNHSSDENVWFQKSVKREKGYEDYYMW 165 >BT016068-1|AAV36953.1| 630|Drosophila melanogaster LP11544p protein. Length = 630 Score = 38.7 bits (86), Expect = 0.010 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 T+ +F+ L K+ I++I+D +PN+ WF +S + D+++W Sbjct: 116 TMADFEHLMEVAKKLDIKIILDFVPNHSSDECEWFRRSAARDPEFKDFYVW 166 >AY069158-1|AAL39303.1| 534|Drosophila melanogaster GH18222p protein. Length = 534 Score = 38.7 bits (86), Expect = 0.010 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 T+ +F+ L K+ I++I+D +PN+ WF +S + D+++W Sbjct: 20 TMADFEHLMEVAKKLDIKIILDFVPNHSSDECEWFRRSAARDPEFKDFYVW 70 >AE013599-655|AAF59085.2| 630|Drosophila melanogaster CG30359-PA protein. Length = 630 Score = 38.7 bits (86), Expect = 0.010 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = +3 Query: 603 TLDEFKILFNKIXKIGIRVIVDLIPNYVFTNHTWFVQSENSTXPYTDYFIW 755 T+ +F+ L K+ I++I+D +PN+ WF +S + D+++W Sbjct: 116 TMADFEHLMEVAKKLDIKIILDFVPNHSSDECEWFRRSAARDPEFKDFYVW 166 >J03251-1|AAA28714.1| 846|Drosophila melanogaster myospheroid protein protein. Length = 846 Score = 31.1 bits (67), Expect = 2.0 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 298 ERRY*SMLTIPSG*TC-VGRCSCCSGWPGCACSPGLLQSLYAHPSAARPNPGHGT 459 ER + + P TC GRC C GW G C P GHGT Sbjct: 607 ERNRNQLCSGPDHGTCECGRCKCKPGWTGSNCGCQESNDTCMPPGGGEICSGHGT 661 >AY113499-1|AAM29504.1| 846|Drosophila melanogaster RE55238p protein. Length = 846 Score = 31.1 bits (67), Expect = 2.0 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 298 ERRY*SMLTIPSG*TC-VGRCSCCSGWPGCACSPGLLQSLYAHPSAARPNPGHGT 459 ER + + P TC GRC C GW G C P GHGT Sbjct: 607 ERNRNQLCSGPDHGTCECGRCKCKPGWTGSNCGCQESNDTCMPPGGGEICSGHGT 661 >AE014298-1112|AAF46313.2| 846|Drosophila melanogaster CG1560-PA protein. Length = 846 Score = 31.1 bits (67), Expect = 2.0 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 298 ERRY*SMLTIPSG*TC-VGRCSCCSGWPGCACSPGLLQSLYAHPSAARPNPGHGT 459 ER + + P TC GRC C GW G C P GHGT Sbjct: 607 ERNRNQLCSGPDHGTCECGRCKCKPGWTGSNCGCQESNDTCMPPGGGEICSGHGT 661 >AE014296-2343|AAF49771.3| 2294|Drosophila melanogaster CG32133-PA protein. Length = 2294 Score = 30.7 bits (66), Expect = 2.7 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 392 EHAQPGHPEQHEQRPTQVHPEGIVSIL-QYLLSRHPSELP 276 + Q HP+ +Q+ Q HP+ I L Q L +HP ++P Sbjct: 404 QQEQQPHPQPLQQQLAQQHPQQIAQQLPQQLSQQHPQQIP 443 >BT003171-1|AAO24926.1| 443|Drosophila melanogaster SD07604p protein. Length = 443 Score = 30.3 bits (65), Expect = 3.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 416 YNDCNSPGEHAQPGHPEQHEQRPTQVH 336 +++ + P H QP HP QH Q Q+H Sbjct: 306 HHNPHMPPHHHQPQHPHQHPQHHPQLH 332 >BT001477-1|AAN71232.1| 443|Drosophila melanogaster LD21345p protein. Length = 443 Score = 30.3 bits (65), Expect = 3.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 416 YNDCNSPGEHAQPGHPEQHEQRPTQVH 336 +++ + P H QP HP QH Q Q+H Sbjct: 306 HHNPHMPPHHHQPQHPHQHPQHHPQLH 332 >AL023893-1|CAA19655.1| 485|Drosophila melanogaster EG:132E8.1 protein. Length = 485 Score = 30.3 bits (65), Expect = 3.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 416 YNDCNSPGEHAQPGHPEQHEQRPTQVH 336 +++ + P H QP HP QH Q Q+H Sbjct: 306 HHNPHMPPHHHQPQHPHQHPQHHPQLH 332 >AE014298-190|AAS65244.1| 443|Drosophila melanogaster CG3056-PB, isoform B protein. Length = 443 Score = 30.3 bits (65), Expect = 3.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 416 YNDCNSPGEHAQPGHPEQHEQRPTQVH 336 +++ + P H QP HP QH Q Q+H Sbjct: 306 HHNPHMPPHHHQPQHPHQHPQHHPQLH 332 >AE014298-189|AAF45613.1| 485|Drosophila melanogaster CG3056-PA, isoform A protein. Length = 485 Score = 30.3 bits (65), Expect = 3.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 416 YNDCNSPGEHAQPGHPEQHEQRPTQVH 336 +++ + P H QP HP QH Q Q+H Sbjct: 306 HHNPHMPPHHHQPQHPHQHPQHHPQLH 332 >M16152-1|AAB59220.1| 2703|Drosophila melanogaster Notch growth factor protein. Length = 2703 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 2645 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 2675 >K03508-1|AAA28725.1| 2703|Drosophila melanogaster developmental protein protein. Length = 2703 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 2645 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 2675 >BT023499-1|AAY84899.1| 1400|Drosophila melanogaster LD34134p protein. Length = 1400 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 1342 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 1372 >AY795937-1|AAY27534.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795936-1|AAY27530.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795935-1|AAY27526.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795934-1|AAY27522.1| 913|Drosophila melanogaster notch protein. Length = 913 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 855 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 885 >AY795933-1|AAY27518.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795932-1|AAY27514.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795931-1|AAY27510.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795930-1|AAY27506.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795929-1|AAY27502.1| 912|Drosophila melanogaster notch protein. Length = 912 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 854 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 884 >AY795928-1|AAY27498.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795927-1|AAY27494.1| 912|Drosophila melanogaster notch protein. Length = 912 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 854 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 884 >AY795926-1|AAY27490.1| 916|Drosophila melanogaster notch protein. Length = 916 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 858 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 888 >AY795925-1|AAY27486.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795924-1|AAY27482.1| 913|Drosophila melanogaster notch protein. Length = 913 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 855 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 885 >AY795923-1|AAY27478.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795922-1|AAY27474.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795921-1|AAY27470.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795920-1|AAY27466.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795919-1|AAY27462.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795918-1|AAY27458.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795917-1|AAY27454.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795916-1|AAY27450.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795915-1|AAY27446.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795914-1|AAY27442.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AY795913-1|AAY27438.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795912-1|AAY27434.1| 910|Drosophila melanogaster notch protein. Length = 910 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 852 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 882 >AY795911-1|AAY27429.1| 911|Drosophila melanogaster notch protein. Length = 911 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 853 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 883 >AL035436-2|CAB37610.1| 2704|Drosophila melanogaster EG:140G11.1,FBgn0004647;N protein. Length = 2704 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 2646 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 2676 >AE014298-493|AAF45848.2| 2703|Drosophila melanogaster CG3936-PA protein. Length = 2703 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 400 LLQSLYAHPSAARPNPGHGTNSVPWSDWTWS 492 L+Q+L ++P+ + +PGH ++S P S+ WS Sbjct: 2645 LVQTLDSYPTPSPESPGHWSSSSPRSNSDWS 2675 >AE014298-591|AAF45913.2| 942|Drosophila melanogaster CG32778-PA protein. Length = 942 Score = 29.5 bits (63), Expect = 6.2 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 379 GCACSPGLLQSLY-AHPSAARPNPGHGTNSVPWSDWTWSMPS 501 G SPG +S Y AHP P+PGH P S + S P+ Sbjct: 321 GGELSPGTARSAYEAHPGHPHPHPGHPHPHPPVSLSSLSSPA 362 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,386,465 Number of Sequences: 53049 Number of extensions: 750891 Number of successful extensions: 3072 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 2644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3061 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4126982652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -