BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D06 (839 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 4.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 4.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 4.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 4.6 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 4.6 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 4.6 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 8.1 AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 22 8.1 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 164 PSRHYRSGLR 135 P RHYRSGL+ Sbjct: 139 PLRHYRSGLK 148 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 227 RWSCLWASGHQAGCRAPGSKAPSRHYR 147 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 227 RWSCLWASGHQAGCRAPGSKAPSRHYR 147 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 227 RWSCLWASGHQAGCRAPGSKAPSRHYR 147 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 4.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 76 SIEKNSNQNA*VHLCTRRPS 135 SI +NSN++ C RRPS Sbjct: 33 SISRNSNRSESSGYCGRRPS 52 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.6 bits (46), Expect = 4.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 76 SIEKNSNQNA*VHLCTRRPS 135 SI +NSN++ C RRPS Sbjct: 33 SISRNSNRSESSGYCGRRPS 52 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 8.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 263 ETGAGKHVPRAVFVDLEPTVVDEVRTDTYRQL 358 E A H+ + D+EPTV RQL Sbjct: 236 ERRAQSHLEAHCYFDIEPTVQQHQPVTVNRQL 267 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 21.8 bits (44), Expect = 8.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 198 MARCPQTRPSGVETILSTLSSARPE 272 +A+ P + T+ ST+SSA+PE Sbjct: 7 VAQLPHHLSPNMPTMDSTVSSAKPE 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,380 Number of Sequences: 438 Number of extensions: 4467 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26945694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -