BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D04 (850 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 25 0.88 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 8.2 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 25.0 bits (52), Expect = 0.88 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 240 TVTSTASKSERIALLLLKHSEKENIQNFTSLYYENYALISTL 115 TVT+ + I ++L+ H I++ + Y +Y ISTL Sbjct: 143 TVTTILAAIVGIVMVLIIHPGDPRIKSVVTAYKADYTKISTL 184 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 8.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 540 LVQQISTLSWQSSSPNLTSSTPH 472 +V + S S +S SP+L +S PH Sbjct: 32 IVDRRSPSSSRSPSPSLLTSQPH 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,365 Number of Sequences: 438 Number of extensions: 4459 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -