BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D02 (846 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33974| Best HMM Match : Coprogen_oxidas (HMM E-Value=0) 83 2e-22 SB_13861| Best HMM Match : Collagen (HMM E-Value=0.00048) 33 0.39 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 31 0.89 SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 31 0.89 SB_39893| Best HMM Match : Retrotrans_gag (HMM E-Value=0.21) 31 0.89 SB_39683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.89 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 31 0.89 SB_20012| Best HMM Match : Retrotrans_gag (HMM E-Value=0.005) 31 0.89 SB_52164| Best HMM Match : Retrotrans_gag (HMM E-Value=0.21) 31 0.89 SB_52157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_29035| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.89 SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_22197| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.89 SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 31 0.89 SB_15963| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.89 SB_15492| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 31 0.89 SB_15389| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 31 0.89 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 31 0.89 SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18) 31 0.89 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 31 1.2 SB_31142| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_50371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_39434| Best HMM Match : JmjC (HMM E-Value=0.12) 31 1.6 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 31 1.6 SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) 30 2.7 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 30 2.7 SB_19747| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_52096| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) 29 4.7 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 29 6.3 SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_33974| Best HMM Match : Coprogen_oxidas (HMM E-Value=0) Length = 539 Score = 83.4 bits (197), Expect(2) = 2e-22 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = +2 Query: 413 GRVFEKAGVNISVVSGKLPPAAIQQMRSRGKNLQNAELPFFAAGVSAVIHPRNPHGP 583 G+VFEKAGVN+SVV G L A QQM+SRGK + +LPFFA G+S+VIHPRNP+ P Sbjct: 284 GKVFEKAGVNVSVVYGTLAAKAAQQMKSRGKGFKGEDLPFFACGISSVIHPRNPYVP 340 Score = 72.1 bits (169), Expect = 5e-13 Identities = 31/57 (54%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +1 Query: 673 YYLNEDDALHFHLTLKHACDDHDSSYYARFXKWCDDXFYXPTXVKGXGXRD-FFDDL 840 YYLNE D +HFH LK CD HD+SYY RF WCD F+ P + G FFDDL Sbjct: 371 YYLNEQDVMHFHGVLKRVCDKHDASYYQRFKSWCDKYFFIPHRGECRGVGGIFFDDL 427 Score = 58.8 bits (136), Expect = 5e-09 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 573 PMVPTIHFNYRYFEVQDKNGVQW-WFGGGTDLTP 671 P VPT+HFNYRYFEV D +G + WFGGGTDLTP Sbjct: 337 PYVPTVHFNYRYFEVTDIDGQKHAWFGGGTDLTP 370 Score = 40.7 bits (91), Expect(2) = 2e-22 Identities = 14/35 (40%), Positives = 27/35 (77%) Frame = +2 Query: 203 KNYMANPITPVEQLEQNKDDMKTQMELLIMRIQAE 307 + +M P+T ++ LE+NKD M+T+ME++I++ Q + Sbjct: 251 QTFMGKPLTDIKTLEKNKDSMRTKMEVMILKAQGK 285 >SB_13861| Best HMM Match : Collagen (HMM E-Value=0.00048) Length = 763 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 2/79 (2%) Frame = -1 Query: 636 GPHSYPGPQSIYS*SGWWGPWGFLGWMTALTPAAKNGS--SAFCRFLPLLRIC*MAAGGS 463 GP PGPQ + G GP G +G + P GS S+ C+++ + AAG Sbjct: 177 GPQGPPGPQGLPGPQGVPGPAGDIGPSGSSGPQGPPGSFNSSLCQYVKKSSVA-TAAGDG 235 Query: 462 FPETTDIFTPAFSKTLPSC 406 + P + + +P C Sbjct: 236 ADSDIVVTEPTWFRKVPLC 254 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 998 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_39893| Best HMM Match : Retrotrans_gag (HMM E-Value=0.21) Length = 137 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_39683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 579 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 52 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 97 >SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1022 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_20012| Best HMM Match : Retrotrans_gag (HMM E-Value=0.005) Length = 202 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 107 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 152 >SB_52164| Best HMM Match : Retrotrans_gag (HMM E-Value=0.21) Length = 137 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_52157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 272 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 317 >SB_29035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 26 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 71 >SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 538 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 209 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 254 >SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_22197| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 528 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 870 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_15963| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 434 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 73 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 118 >SB_15492| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 580 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_15389| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 462 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 208 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 253 >SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1677 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 133 >SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18) Length = 1046 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQESTKRRA 525 HL +TRRQ ES EY+ L+ S C S A Q E + R A Sbjct: 433 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEESIRDA 478 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/70 (31%), Positives = 36/70 (51%) Frame = +2 Query: 173 KAKMKEIMQLKNYMANPITPVEQLEQNKDDMKTQMELLIMRIQAEFCRALEKEEDKEAKF 352 K ++K++ + KN + + VE L ++ Q ELL R + C+ALE E+ E Sbjct: 429 KLEIKKLRREKNILTKNVANVEDLR--REVYHHQRELLRERTR---CKALE--EELENPM 481 Query: 353 TVDRWTRKEG 382 + RW + EG Sbjct: 482 NIHRWRKLEG 491 >SB_31142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 236 EQLEQNKDDMKTQMELLIMRIQAEFCRALEKEEDKEAK 349 E +EQ D++ QM L MRI+ E ++K+E +E K Sbjct: 170 EHMEQLDDELDQQMSRLEMRIKKELENKIKKKEPEEQK 207 >SB_50371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 673 YYLNEDDALHFHLTLKHACDDHDSSYYAR 759 Y + +D L FH+T KHA + D+ +AR Sbjct: 10 YIIAGEDQLFFHITCKHAAPNTDAKRFAR 38 >SB_39434| Best HMM Match : JmjC (HMM E-Value=0.12) Length = 672 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -3 Query: 640 HWTPFLSWTSKYL*LKWMVGTMGVPWVDDGTHTGCKKRE 524 HW WT+++L K+ V + G + GC+K E Sbjct: 329 HWPAIQKWTNEFLRAKYSNTDTRVAFAPSGEYEGCEKAE 367 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 30.7 bits (66), Expect = 1.6 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 6/106 (5%) Frame = +2 Query: 176 AKMKEIMQLKNYMANPITPVEQLEQNKDDMKTQMELLIMRIQAEFCRALEKEEDKE---- 343 AK ++I LK + + Q++ + D + + L +I+ + +L + DK+ Sbjct: 881 AKNRDIKDLKETVVKFKRRISQIQVDIDILMNEKTELAKQIEKQVSLSLSESSDKQHSMN 940 Query: 344 --AKFTVDRWTRKEGGGGITCVLQDGRVFEKAGVNISVVSGKLPPA 475 K+ + RK G C+L+ ++ NIS++ L A Sbjct: 941 EKEKYAMPPLLRKSSSTGDACILKAEEQNQQLLANISILETNLKKA 986 >SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 1048 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 394 HLCSTRRQSL*ESRSEYISCLRETSSSC--HSADAEQRQEST 513 HL +TRRQ ES EY+ L+ S C S A Q E + Sbjct: 88 HLLATRRQQPSESLDEYLQALKTLSKDCDFKSVTAAQYSEES 129 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 546 TPAAKNGSSA--FCRFLPLLRIC*MAAGGSFPETTDIFTPAFSKTLPSCRTQ 397 TP+A G S C + A GGSF +T + +P +KT P CR + Sbjct: 2309 TPSANTGPSVDHTCGNSSCYYMYVEAGGGSFLDTARLTSPNMTKTGPGCRME 2360 >SB_19747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 411 SCRTQVIPPPPSLRVH 364 SC T +PPPPS RVH Sbjct: 89 SCSTWKVPPPPSHRVH 104 >SB_52096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 997 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = -1 Query: 669 GSDRCRLR---TTTGPHSYPGPQSI 604 G D CR+R T TGP PGP++I Sbjct: 311 GCDYCRIRCIATCTGPEMIPGPETI 335 >SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) Length = 2074 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 411 SCRTQVIPPPPSLRVH 364 SC T +PPPPS RVH Sbjct: 686 SCSTWKVPPPPSHRVH 701 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/90 (21%), Positives = 38/90 (42%) Frame = +2 Query: 182 MKEIMQLKNYMANPITPVEQLEQNKDDMKTQMELLIMRIQAEFCRALEKEEDKEAKFTVD 361 +KE+ LKN + + +E+ + + ++K I + + A+ ++E EAK Sbjct: 87 LKEVASLKNDLQSMGEQLEREKAHNAELKAIKTQQISALTVKLATAIRQKEAAEAKMHPS 146 Query: 362 RWTRKEGGGGITCVLQDGRVFEKAGVNISV 451 T + + C QD + E + V Sbjct: 147 HMT-NDSADPVPCQTQDAQETENVSLRNEV 175 >SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4482 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/45 (26%), Positives = 27/45 (60%) Frame = +2 Query: 197 QLKNYMANPITPVEQLEQNKDDMKTQMELLIMRIQAEFCRALEKE 331 +L ++ + +TP EQ+E + T++ + ++++ E CR+L E Sbjct: 3181 RLASWFSTGLTPEEQVELQFEAYLTKLAVKSLKMKEEECRSLRAE 3225 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,601,672 Number of Sequences: 59808 Number of extensions: 516300 Number of successful extensions: 1653 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1640 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -