BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_D02 (846 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 3.8 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 6.7 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 23 8.8 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 24.6 bits (51), Expect = 3.8 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 221 PITPVEQLEQNKDDMKTQMELLIMRIQAEFCRALEKEEDKE 343 P TP+ +L + DD + ++ M A C A E D E Sbjct: 34 PATPMMELCYSSDDDELNSTIIAMPEPASECEAAEAAMDLE 74 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.8 bits (49), Expect = 6.7 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 595 KWMVGTMGVPWVD 557 KW G G PW+D Sbjct: 329 KWASGQTGFPWID 341 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.4 bits (48), Expect = 8.8 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +2 Query: 383 GGGITCVLQDGRVFEKAGVNISVVSGKLPPAAIQQMRSR----GKNLQNAELPF 532 G G ++ R+F+KAG+ I+ + + A Q+ ++ G + NA PF Sbjct: 333 GRGARDEVRVSRIFQKAGITINELGSEAYAATEIQLVNKFGGDGVQIFNANRPF 386 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 831,986 Number of Sequences: 2352 Number of extensions: 16892 Number of successful extensions: 39 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -