BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_C21 (868 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 28 0.42 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 28 0.42 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 28 0.42 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 28 0.42 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 28 0.42 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 28 0.42 AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha su... 26 1.7 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 25 3.0 AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. 23 9.1 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 27.9 bits (59), Expect = 0.42 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -2 Query: 726 ESNPNFSLMIFFKWWYTSEPILMASLKVDAPVGKIMNSCMASLFPACDPP 577 ES F +I + W+ S IL + K D KIM S + FP D P Sbjct: 244 ESKALFKTIITYPWFQHSSVILFLNKK-DLLEEKIMYSHLVDYFPEYDGP 292 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 27.9 bits (59), Expect = 0.42 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -2 Query: 726 ESNPNFSLMIFFKWWYTSEPILMASLKVDAPVGKIMNSCMASLFPACDPP 577 ES F +I + W+ S IL + K D KIM S + FP D P Sbjct: 101 ESKALFKTIITYPWFQHSSVILFLNKK-DLLEEKIMYSHLVDYFPEYDGP 149 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 27.9 bits (59), Expect = 0.42 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -2 Query: 726 ESNPNFSLMIFFKWWYTSEPILMASLKVDAPVGKIMNSCMASLFPACDPP 577 ES F +I + W+ S IL + K D KIM S + FP D P Sbjct: 58 ESKALFKTIITYPWFQHSSVILFLNKK-DLLEEKIMYSHLVDYFPEYDGP 106 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 27.9 bits (59), Expect = 0.42 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -2 Query: 726 ESNPNFSLMIFFKWWYTSEPILMASLKVDAPVGKIMNSCMASLFPACDPP 577 ES F +I + W+ S IL + K D KIM S + FP D P Sbjct: 57 ESKALFKTIITYPWFQHSSVILFLNKK-DLLEEKIMYSHLVDYFPEYDGP 105 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 27.9 bits (59), Expect = 0.42 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -2 Query: 726 ESNPNFSLMIFFKWWYTSEPILMASLKVDAPVGKIMNSCMASLFPACDPP 577 ES F +I + W+ S IL + K D KIM S + FP D P Sbjct: 58 ESKALFKTIITYPWFQHSSVILFLNKK-DLLEEKIMYSHLVDYFPEYDGP 106 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 27.9 bits (59), Expect = 0.42 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -2 Query: 726 ESNPNFSLMIFFKWWYTSEPILMASLKVDAPVGKIMNSCMASLFPACDPP 577 ES F +I + W+ S IL + K D KIM S + FP D P Sbjct: 57 ESKALFKTIITYPWFQHSSVILFLNKK-DLLEEKIMYSHLVDYFPEYDGP 105 >AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha subunit AgGq5 protein. Length = 127 Score = 25.8 bits (54), Expect = 1.7 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = -2 Query: 726 ESNPNFSLMIFFKWWYTSEPILMASLKVDAPVGKIMNSCMASLFPACD 583 ES F +I + W+ S IL + K D KIM S + FP D Sbjct: 58 ESKALFKTIITYPWFQHSSVILFLNKK-DLLEEKIMYSHLVDYFPEYD 104 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 25.0 bits (52), Expect = 3.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 82 RYPYLTKLHLTSRVWQKYKDLV 17 RY L + L SR+W+ Y D+V Sbjct: 67 RYANLDLVELHSRMWEDYGDIV 88 >AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. Length = 99 Score = 23.4 bits (48), Expect = 9.1 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 463 SCC*GWCCQEECSAVQA 513 SC WCC+ +C +A Sbjct: 75 SCTFHWCCEVKCKLCRA 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 852,487 Number of Sequences: 2352 Number of extensions: 17235 Number of successful extensions: 23 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92613024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -