BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_C20 (844 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.5 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 3.5 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 8.1 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 1.5 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 305 PNLDEISDVVVQPYNSLLTLKRLT--ESADCVMVLDNTALNRIASDRLHIQNP 457 PNL + + PY+SLL++ L S D V N A + +L ++ P Sbjct: 657 PNLASANISQLDPYSSLLSITNLAAEHSGDYTCVAANPAAEVRYTAKLQVKVP 709 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 3.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 563 PLIPTPRLHFLMTGYTPLSADHE 631 P +PT + + YTPL DH+ Sbjct: 183 PPVPTVTSACVGSAYTPLKEDHD 205 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 413 LYYPEPSRSLH 381 L YPEP+ SLH Sbjct: 38 LVYPEPNPSLH 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,942 Number of Sequences: 438 Number of extensions: 4436 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -