BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_C17 (851 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 32 0.007 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 7.1 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 22 7.1 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 22 7.1 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 9.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.4 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 31.9 bits (69), Expect = 0.007 Identities = 23/79 (29%), Positives = 30/79 (37%) Frame = +3 Query: 351 PYPVEKKIPYPVKVHVPQPYPVCQTCPLPS*RDCQGTSSRTATLPSRKEGALPSTCPSRQ 530 P + K P P +P C S R G S RT + +K GA + + Sbjct: 171 PVDLSKSEPEKKTESQPMLWPAWVYCTRYSDRPSSGRSPRTRRV--KKPGAKQGAPTAEE 228 Query: 531 TRPRQGICARTLPRLKRKF 587 RPR L RLK +F Sbjct: 229 KRPRTAFSGAQLARLKHEF 247 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 38 NLLVQHHETNARGRQ 82 N+L++HHE A G Q Sbjct: 113 NMLLRHHEEVADGHQ 127 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 38 NLLVQHHETNARGRQ 82 N+L++HHE A G Q Sbjct: 113 NMLLRHHEEVADGHQ 127 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 38 NLLVQHHETNARGRQ 82 N+L++HHE A G Q Sbjct: 113 NMLLRHHEEVADGHQ 127 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 658 PVHVPAPYPVY 690 P+H P P PVY Sbjct: 159 PLHYPPPPPVY 169 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 420 DKRGRVGERALSRGRGFSF 364 D+RGR+G A R + SF Sbjct: 2121 DRRGRIGPYAYLRDQWVSF 2139 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,044 Number of Sequences: 336 Number of extensions: 2828 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -