BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_C16 (839 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0017 + 12297539-12297697,12298191-12298229,12298457-122988... 32 0.65 02_04_0054 + 19279579-19280772 32 0.65 12_01_0889 - 8567209-8567490,8567539-8568009,8568116-8568136 31 1.5 12_02_0279 - 16704284-16704925 30 2.0 12_01_0551 + 4446937-4447353,4449141-4450013,4451206-4451244,445... 29 3.5 03_04_0175 - 18092055-18092583,18092819-18093378 29 3.5 12_02_0043 + 12762257-12762678,12762751-12762778 29 4.6 03_05_0358 - 23438416-23439282,23440116-23440163,23440343-234403... 28 8.1 01_02_0007 + 10132380-10133201 25 9.5 >11_04_0017 + 12297539-12297697,12298191-12298229,12298457-12298825, 12298921-12299058 Length = 234 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -1 Query: 275 QVPRAGLRRRGGRSEDVQKQGRV*GRVLGETDCYQHRQQKR 153 +VP A ++ GGR D + GR+ G G C RQ K+ Sbjct: 2 EVPAASVKGGGGRRSDEEAPGRIAGNGAGNVACLFTRQGKK 42 >02_04_0054 + 19279579-19280772 Length = 397 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = -1 Query: 410 RHAGVINVHPFIVLVTQIVGDAFARFPVLIRKHAVALRRLNDDVFQVPRAGL--RRRGGR 237 RH G+ + + T ++ +A+ +L+ KHA L + ++ V RA L RRR R Sbjct: 316 RHPGIFYLSRVLGTQTVVLREAYGGGSLLLAKHAHPLATIREEYSAVMRAALPPRRRRSR 375 Query: 236 SED 228 D Sbjct: 376 ESD 378 >12_01_0889 - 8567209-8567490,8567539-8568009,8568116-8568136 Length = 257 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +3 Query: 426 DVRFGEEDCQESVEICCTNPITEPVPKPQPDPS 524 D+RF ++D E++E P+++P +P+P PS Sbjct: 166 DLRFIQKDSGETLEFHSKEPLSQPPIEPEPCPS 198 >12_02_0279 - 16704284-16704925 Length = 213 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 441 EEDCQESVEICCTNPITEPVPKPQPDPSKVEGMRL 545 +ED E++E+ P ++P KP+P PS +G+ L Sbjct: 72 KEDSGETLELLSREPASQPPIKPKPCPSGSQGIVL 106 >12_01_0551 + 4446937-4447353,4449141-4450013,4451206-4451244, 4452339-4452581 Length = 523 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 474 CTNPITEPVPKPQPDPSKVEGMRLQ 548 C P P+P+P+P P VE +R++ Sbjct: 37 CPPPPPPPLPRPRPPPPAVEALRIR 61 >03_04_0175 - 18092055-18092583,18092819-18093378 Length = 362 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +3 Query: 426 DVRFGEEDCQESVEICCTNPITEPVPKPQPDPS 524 D+RF ++D E++E+ P ++P +P+P PS Sbjct: 226 DLRFIQKDSGETLELHSKEPPSQPPIEPEPCPS 258 >12_02_0043 + 12762257-12762678,12762751-12762778 Length = 149 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 426 DVRFGEEDCQESVEICCTNPITEPVPKPQPDPS 524 D+ F +ED E++E+ P ++P +P+P PS Sbjct: 17 DLHFIQEDSGETLELHSKEPPSQPPIEPEPCPS 49 >03_05_0358 - 23438416-23439282,23440116-23440163,23440343-23440382, 23440459-23440610 Length = 368 Score = 28.3 bits (60), Expect = 8.1 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +2 Query: 149 AFVFAGGAGNSRSRPGHDLRPCLASEHLRNAPHAGEARHGEPGR 280 A V +GG G R R L +A H +G RHG PGR Sbjct: 156 AVVGSGGVGRRRRRTWRRLAEAVAGGH-----DSGHRRHGGPGR 194 >01_02_0007 + 10132380-10133201 Length = 273 Score = 25.4 bits (53), Expect(2) = 9.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 480 NPITEPVPKPQPDP 521 NP +P+P+PQP P Sbjct: 67 NPQPQPLPQPQPQP 80 Score = 21.0 bits (42), Expect(2) = 9.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 495 PVPKPQPDPSKVEG 536 P P+PQP P + G Sbjct: 88 PQPQPQPQPLPLPG 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,233,882 Number of Sequences: 37544 Number of extensions: 534152 Number of successful extensions: 2304 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2240 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -