BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_C10 (849 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20H4.09 |||ATP-dependent RNA helicase, spliceosomal |Schizos... 29 0.83 SPBC3H7.14 |mug176||BRCT domain protein|Schizosaccharomyces pomb... 28 1.9 >SPAC20H4.09 |||ATP-dependent RNA helicase, spliceosomal |Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 29.1 bits (62), Expect = 0.83 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -2 Query: 632 SSRRYRGRVSRLYTEQAPSLPPQQF 558 + R RG+V RLYTE+A SL ++F Sbjct: 354 AGRTMRGKVFRLYTEKAYSLMKEEF 378 >SPBC3H7.14 |mug176||BRCT domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 406 Score = 27.9 bits (59), Expect = 1.9 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 362 SLHRYLRNYVLHKIL--CHRCPFCLVSSLRLPSVCLSPPW 249 SL N V H +L C + +SS ++P VC+SP W Sbjct: 194 SLQMTEENPVSHAVLYDCSQETLKKISSAQVPIVCVSPKW 233 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,451,071 Number of Sequences: 5004 Number of extensions: 41228 Number of successful extensions: 109 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -