BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_C09 (863 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 4.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 4.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 4.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.4 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 5.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.4 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 9.4 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 ARGHIIEKIPELPLGCSRQSPG 598 A GH ++K E +GC SPG Sbjct: 782 AIGHWLQKATEHVIGCVLCSPG 803 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 ARGHIIEKIPELPLGCSRQSPG 598 A GH ++K E +GC SPG Sbjct: 782 AIGHWLQKATEHVIGCVLCSPG 803 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 ARGHIIEKIPELPLGCSRQSPG 598 A GH ++K E +GC SPG Sbjct: 782 AIGHWLQKATEHVIGCVLCSPG 803 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 ARGHIIEKIPELPLGCSRQSPG 598 A GH ++K E +GC SPG Sbjct: 782 AIGHWLQKATEHVIGCVLCSPG 803 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 274 CVSKEAGHQTSAESW 318 C K+ GH+ S SW Sbjct: 1152 CEEKKPGHKPSTSSW 1166 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 ARGHIIEKIPELPLGCSRQSPG 598 A GH ++K E +GC SPG Sbjct: 208 AVGHWMQKATEHVIGCVLCSPG 229 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 ARGHIIEKIPELPLGCSRQSPG 598 A GH ++K E +GC SPG Sbjct: 522 AVGHWMQKATEHVIGCVLCSPG 543 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 ARGHIIEKIPELPLGCSRQSPG 598 A GH ++K E +GC SPG Sbjct: 755 AVGHWMQKATEHVIGCVLCSPG 776 Score = 21.8 bits (44), Expect = 7.1 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 207 AHTSGPGQ*CSRFYVQELEAALLREQGGWSPNQCRIMGYR 326 A TSG G+ FY+ E + + G S N I +R Sbjct: 1376 AQTSGGGENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFR 1415 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 ARGHIIEKIPELPLGCSRQSPG 598 A GH ++K E +GC SPG Sbjct: 755 AVGHWMQKATEHVIGCVLCSPG 776 Score = 21.8 bits (44), Expect = 7.1 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 207 AHTSGPGQ*CSRFYVQELEAALLREQGGWSPNQCRIMGYR 326 A TSG G+ FY+ E + + G S N I +R Sbjct: 1376 AQTSGGGENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFR 1415 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 189 PVRIQGAHTSGPGQ*CSRFYVQELEAAL 272 PVRI G H G C++ E AL Sbjct: 196 PVRIMGVHRPGFDNDCNKNTSTSKEIAL 223 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,132 Number of Sequences: 336 Number of extensions: 4261 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -