BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_C01 (841 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11910.1 68414.m01374 aspartyl protease family protein contai... 132 3e-31 At1g62290.1 68414.m07027 aspartyl protease family protein contai... 129 2e-30 At4g04460.1 68417.m00648 aspartyl protease family protein contai... 128 5e-30 At4g22050.1 68417.m03189 aspartyl protease family protein contai... 93 3e-19 At1g69100.1 68414.m07907 aspartyl protease family protein contai... 83 2e-16 At3g42550.1 68416.m04414 aspartyl protease family protein weak s... 48 8e-06 At3g51350.1 68416.m05622 aspartyl protease family protein contai... 43 2e-04 At1g31450.1 68414.m03851 aspartyl protease family protein contai... 43 2e-04 At5g45120.1 68418.m05539 aspartyl protease family protein contai... 42 4e-04 At1g08210.1 68414.m00907 aspartyl protease family protein contai... 42 4e-04 At1g05840.1 68414.m00611 aspartyl protease family protein contai... 41 9e-04 At2g35615.1 68415.m04367 aspartyl protease family protein contai... 41 0.001 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 40 0.002 At3g12700.1 68416.m01587 aspartyl protease family protein contai... 40 0.002 At2g36670.2 68415.m04498 aspartyl protease family protein contai... 40 0.002 At2g28010.1 68415.m03394 aspartyl protease family protein contai... 40 0.002 At5g36260.1 68418.m04374 aspartyl protease family protein contai... 40 0.003 At5g22850.1 68418.m02671 aspartyl protease family protein contai... 40 0.003 At3g51340.1 68416.m05620 aspartyl protease family protein contai... 39 0.005 At2g36670.1 68415.m04497 aspartyl protease family protein contai... 39 0.005 At2g23945.1 68415.m02859 chloroplast nucleoid DNA-binding protei... 39 0.005 At3g52500.1 68416.m05773 aspartyl protease family protein contai... 38 0.011 At2g28220.1 68415.m03426 aspartyl protease family protein contai... 38 0.011 At2g28030.1 68415.m03397 aspartyl protease family protein contai... 38 0.011 At1g65240.1 68414.m07396 aspartyl protease family protein contai... 38 0.011 At5g33340.1 68418.m03957 aspartyl protease family protein contai... 37 0.015 At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protei... 37 0.015 At2g28040.1 68415.m03399 aspartyl protease family protein contai... 37 0.015 At1g64830.1 68414.m07350 aspartyl protease family protein contai... 37 0.015 At3g18490.1 68416.m02350 aspartyl protease family protein contai... 37 0.019 At5g43100.1 68418.m05261 aspartyl protease family protein low si... 36 0.025 At3g51360.1 68416.m05624 aspartyl protease family protein contai... 36 0.025 At1g66180.1 68414.m07512 aspartyl protease family protein contai... 36 0.025 At1g01300.1 68414.m00046 aspartyl protease family protein contai... 36 0.025 At3g59080.1 68416.m06586 aspartyl protease family protein contai... 36 0.033 At3g50050.1 68416.m05472 aspartyl protease family protein contai... 36 0.044 At3g02740.1 68416.m00266 aspartyl protease family protein contai... 36 0.044 At2g42980.1 68415.m05332 aspartyl protease family protein contai... 36 0.044 At5g02190.1 68418.m00140 aspartyl protease family protein contai... 35 0.059 At3g61820.1 68416.m06939 aspartyl protease family protein contai... 35 0.059 At4g35880.1 68417.m05095 aspartyl protease family protein contai... 35 0.077 At3g20015.1 68416.m02532 aspartyl protease family protein contai... 35 0.077 At1g44130.1 68414.m05097 nucellin protein, putative similar to n... 35 0.077 At2g17760.1 68415.m02057 aspartyl protease family protein contai... 34 0.10 At5g10760.1 68418.m01250 aspartyl protease family protein contai... 34 0.14 At3g51330.1 68416.m05619 aspartyl protease family protein contai... 34 0.14 At1g77480.2 68414.m09023 nucellin protein, putative similar to n... 33 0.18 At1g77480.1 68414.m09022 nucellin protein, putative similar to n... 33 0.18 At2g39710.1 68415.m04872 aspartyl protease family protein contai... 33 0.31 At1g09750.1 68414.m01094 chloroplast nucleoid DNA-binding protei... 33 0.31 At5g10770.1 68418.m01252 chloroplast nucleoid DNA-binding protei... 32 0.41 At5g37540.1 68418.m04521 aspartyl protease family protein weak s... 31 0.95 At2g03200.1 68415.m00273 aspartyl protease family protein contai... 31 0.95 At4g33490.1 68417.m04756 nucellin protein, putative similar to n... 31 1.3 At3g54400.1 68416.m06015 aspartyl protease family protein contai... 31 1.3 At5g07030.1 68418.m00796 aspartyl protease family protein contai... 30 1.7 At4g30030.1 68417.m04273 aspartyl protease family protein contai... 29 3.8 At1g52190.1 68414.m05889 proton-dependent oligopeptide transport... 29 5.1 At1g03220.1 68414.m00300 extracellular dermal glycoprotein, puta... 29 5.1 At4g30040.1 68417.m04274 aspartyl protease family contains Pfam ... 28 6.7 At1g25510.1 68414.m03168 aspartyl protease family protein contai... 28 6.7 At5g38950.1 68418.m04710 germin-like protein-related contains so... 28 8.9 >At1g11910.1 68414.m01374 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 506 Score = 132 bits (319), Expect = 3e-31 Identities = 61/89 (68%), Positives = 69/89 (77%) Frame = +1 Query: 325 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 504 L NYLDAQYYG I+IGTPPQ F VVFDTGSSNLWVPS KC Y ++ACLLH KY S +S T Sbjct: 74 LKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKC-YFSLACLLHPKYKSSRSST 132 Query: 505 YVANGTQFAIQYGSGSLSGFLSTDDVTVG 591 Y NG AI YG+G+++GF S D VTVG Sbjct: 133 YEKNGKAAAIHYGTGAIAGFFSNDAVTVG 161 >At1g62290.1 68414.m07027 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 513 Score = 129 bits (312), Expect = 2e-30 Identities = 59/90 (65%), Positives = 69/90 (76%) Frame = +1 Query: 322 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 501 PL NYLDAQYYG I+IGTPPQ F V+FDTGSSNLWVPS KC + +++C H KY S +S Sbjct: 80 PLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFF-SLSCYFHAKYKSSRSS 138 Query: 502 TYVANGTQFAIQYGSGSLSGFLSTDDVTVG 591 TY +G + AI YGSGS+SGF S D VTVG Sbjct: 139 TYKKSGKRAAIHYGSGSISGFFSYDAVTVG 168 >At4g04460.1 68417.m00648 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 508 Score = 128 bits (309), Expect = 5e-30 Identities = 55/90 (61%), Positives = 70/90 (77%) Frame = +1 Query: 322 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 501 PL NYLDAQYYG I+IGTPPQ F V+FDTGSSNLW+PS KC Y ++AC H+KY + +S Sbjct: 78 PLKNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKC-YLSVACYFHSKYKASQSS 136 Query: 502 TYVANGTQFAIQYGSGSLSGFLSTDDVTVG 591 +Y NG +I+YG+G++SG+ S DDV VG Sbjct: 137 SYRKNGKPASIRYGTGAISGYFSNDDVKVG 166 >At4g22050.1 68417.m03189 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 354 Score = 92.7 bits (220), Expect = 3e-19 Identities = 47/90 (52%), Positives = 60/90 (66%) Frame = +1 Query: 325 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 504 L N D YYG I IG P Q+F V+FDTGSS+LWVPS+ ++ N+Y S S+T Sbjct: 38 LKNVKDFLYYGKIQIGNPGQTFTVLFDTGSSSLWVPSE--NWLAKTENPRNRYISSASRT 95 Query: 505 YVANGTQFAIQYGSGSLSGFLSTDDVTVGG 594 + NGT+ ++YG GSL+GFLS D VTVGG Sbjct: 96 FKENGTKAELKYGKGSLTGFLSVDTVTVGG 125 >At1g69100.1 68414.m07907 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 343 Score = 83.4 bits (197), Expect = 2e-16 Identities = 47/108 (43%), Positives = 64/108 (59%), Gaps = 1/108 (0%) Frame = +1 Query: 274 LELLRLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYT 453 + L R +V G S L N+ +YG IS+G+PPQ F VVFDTGS++LWVPSK+ + Sbjct: 22 ISLKRHTLNVGGTSFGGLKNFDGVVFYGEISVGSPPQKFNVVFDTGSTDLWVPSKE--WP 79 Query: 454 NIACLLHNKYDSRKSKT-YVANGTQFAIQYGSGSLSGFLSTDDVTVGG 594 H K+D SKT + G + I Y +GS+ G L+ D+V VGG Sbjct: 80 EETDHKHPKFDKDASKTCRLMKGGEVNIAYETGSVVGILAQDNVNVGG 127 >At3g42550.1 68416.m04414 aspartyl protease family protein weak similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 356 Score = 48.0 bits (109), Expect = 8e-06 Identities = 22/47 (46%), Positives = 26/47 (55%) Frame = +1 Query: 337 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN 477 L A YY + IGTPP+ VV DTGS +WV C + C LHN Sbjct: 74 LSALYYTTVQIGTPPRELDVVIDTGSDLVWVSCNSC----VGCPLHN 116 >At3g51350.1 68416.m05622 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +1 Query: 337 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 432 L + YY +S+GTPP SF V DTGS W+P Sbjct: 98 LGSLYYANVSVGTPPSSFLVALDTGSDLFWLP 129 >At1g31450.1 68414.m03851 aspartyl protease family protein contains eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 445 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/56 (41%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 507 +Y+ ISIGTPP + DTGS WV K C C N +D +KS TY Sbjct: 84 EYFMSISIGTPPSKVFAIADTGSDLTWVQCKPCQ----QCYKQNSPLFDKKKSSTY 135 >At5g45120.1 68418.m05539 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 491 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/49 (42%), Positives = 26/49 (53%) Frame = +1 Query: 319 EPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIAC 465 EPL D Y ++IGTPPQ+ +V DTGS WVP + I C Sbjct: 74 EPLREVRDG-YLITLNIGTPPQAVQVYLDTGSDLTWVPCGNLSFDCIEC 121 >At1g08210.1 68414.m00907 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) {Nicotiana tabacum} Length = 492 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +1 Query: 334 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 447 +L YY + +GTPP+ F V DTGS LWV C+ Sbjct: 79 FLVGLYYTKVKLGTPPREFNVQIDTGSDVLWVSCTSCN 116 >At1g05840.1 68414.m00611 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 485 Score = 41.1 bits (92), Expect = 9e-04 Identities = 28/77 (36%), Positives = 34/77 (44%), Gaps = 6/77 (7%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY------TNIACLLHNKYDSRKSKTYV 510 YY I IGTP +S+ V DTGS +WV +C I L+N D S V Sbjct: 80 YYAKIGIGTPAKSYYVQVDTGSDIMWVNCIQCKQCPRRSTLGIELTLYN-IDESDSGKLV 138 Query: 511 ANGTQFAIQYGSGSLSG 561 + F Q G LSG Sbjct: 139 SCDDDFCYQISGGPLSG 155 >At2g35615.1 68415.m04367 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 447 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 340 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 507 D +++ I+IGTPP + DTGS WV K C C N +D +KS TY Sbjct: 82 DGEFFMSITIGTPPIKVFAIADTGSDLTWVQCKPCQ----QCYKENGPIFDKKKSSTY 135 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 501 +Y I IGTP SF V DTGS+ LW+P C+ A L Y S +K Sbjct: 100 HYTWIDIGTPSVSFLVALDTGSNLLWIP---CNCVQCAPLTSTYYSSLATK 147 >At3g12700.1 68416.m01587 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 461 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +1 Query: 331 NYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY 450 +Y AQY+ I +GTP + F+VV DTGS WV C Y Sbjct: 100 DYGTAQYFTEIRVGTPAKKFRVVVDTGSELTWV---NCRY 136 >At2g36670.2 68415.m04498 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 507 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 334 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 YL Y+ + +G+PP F V DTGS LWV C Sbjct: 95 YLVGLYFTKVKLGSPPTEFNVQIDTGSDILWVTCSSC 131 >At2g28010.1 68415.m03394 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 396 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 4/105 (3%) Frame = +1 Query: 286 RLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLW---VPSKKCHYTN 456 R+ +G SP + + ++ Y + +GTPP + + DTGS W +P C+ N Sbjct: 44 RVSNTQSGSSPYANTVFDNSVYLMKLQVGTPPFEIQAIIDTGSEITWTQCLPCVHCYEQN 103 Query: 457 IACLLHNKYDSRKSKTYVANGTQFAIQYGSGSLS-GFLSTDDVTV 588 +K + K K + + + Y + + G L+T+ +T+ Sbjct: 104 APIFDPSKSSTFKEKRCDGHSCPYEVDYFDHTYTMGTLATETITL 148 >At5g36260.1 68418.m04374 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 482 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKT 504 Y+ I +G+PP+ + V DTGS LWV P KC + + YDS+ S T Sbjct: 78 YFTKIKLGSPPKEYYVQVDTGSDILWVNCAPCPKCPVKTDLGIPLSLYDSKTSST 132 >At5g22850.1 68418.m02671 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 493 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 447 YY + +GTPP+ F V DTGS LWV C+ Sbjct: 81 YYTKLRLGTPPRDFYVQVDTGSDVLWVSCASCN 113 >At3g51340.1 68416.m05620 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 518 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = +1 Query: 331 NYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYV 510 N+L +Y +S+GTP F V DTGS W+P C T C +H+ D+R S++ Sbjct: 85 NFLGFLHYANVSLGTPATWFLVALDTGSDLFWLPC-NCGTT---C-IHDLKDARFSESVP 139 Query: 511 AN 516 N Sbjct: 140 LN 141 >At2g36670.1 68415.m04497 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 512 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 295 YDVTGPS-PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 + V G S P + + + Y+ + +G+PP F V DTGS LWV C Sbjct: 86 FPVQGSSDPYLVGSKMTMLYFTKVKLGSPPTEFNVQIDTGSDILWVTCSSC 136 >At2g23945.1 68415.m02859 chloroplast nucleoid DNA-binding protein-related contains weak similarity to GP|2541876|dbj|BAA22813.1||D26015 CND41, chloroplast nucleoid DNA binding protein {Nicotiana tabacum} Length = 458 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +1 Query: 364 SIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYV 510 S+G PP + DTGSS LW+ + C + + ++H ++ S T+V Sbjct: 101 SVGQPPVPQLTIMDTGSSLLWIQCQPCKHCSSDHMIHPVFNPALSSTFV 149 >At3g52500.1 68416.m05773 aspartyl protease family protein contains Pfam PF00026: eukaryotic aspartyl protease Length = 469 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +1 Query: 322 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 432 PLS Y +S GTP Q+ VFDTGSS +W+P Sbjct: 81 PLSAKSYGGYSVSLSFGTPSQTIPFVFDTGSSLVWLP 117 >At2g28220.1 68415.m03426 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 756 Score = 37.5 bits (83), Expect = 0.011 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 4/98 (4%) Frame = +1 Query: 307 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIACLLH-N 477 G SP + Y + Y + +GTPP DTGS +W C Y+ A + + Sbjct: 407 GASPYADTLYDYSIYLMKLQVGTPPFEIVAEIDTGSDIIWTQCMPCPNCYSQFAPIFDPS 466 Query: 478 KYDSRKSKTYVANGTQFAIQYGSGSLS-GFLSTDDVTV 588 K + + + N + I Y + S G L+T+ VT+ Sbjct: 467 KSSTFREQRCNGNSCHYEIIYADKTYSKGILATETVTI 504 Score = 31.5 bits (68), Expect = 0.72 Identities = 27/105 (25%), Positives = 41/105 (39%), Gaps = 6/105 (5%) Frame = +1 Query: 292 KYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLL 471 K + G SP + + Y + +GTPP DTGS +W C + Sbjct: 63 KNQLQGASPYADTLFDYNIYLMKLQVGTPPFEIAAEIDTGSDLIWTQCMPC--PDCYSQF 120 Query: 472 HNKYDSRKSKTY-----VANGTQFAIQYGSGSLS-GFLSTDDVTV 588 +D KS T+ + I Y + S G L+T+ VT+ Sbjct: 121 DPIFDPSKSSTFNEQRCHGKSCHYEIIYEDNTYSKGILATETVTI 165 >At2g28030.1 68415.m03397 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 392 Score = 37.5 bits (83), Expect = 0.011 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 4/103 (3%) Frame = +1 Query: 292 KYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIAC 465 K + G SP + + Y + +GTPP + DTGS +W C Y+ A Sbjct: 42 KNQLQGASPYADTLFDYNIYLMKLQVGTPPFEIEAEIDTGSDLIWTQCMPCTNCYSQYAP 101 Query: 466 LLHNKYDSR-KSKTYVANGTQFAIQYGSGSLS-GFLSTDDVTV 588 + S K K N + I Y + S G L+T+ VT+ Sbjct: 102 IFDPSNSSTFKEKRCNGNSCHYKIIYADTTYSKGTLATETVTI 144 >At1g65240.1 68414.m07396 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 475 Score = 37.5 bits (83), Expect = 0.011 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 Y+ I +G+PP+ + V DTGS LW+ K C Sbjct: 74 YFTKIKLGSPPKEYHVQVDTGSDILWINCKPC 105 >At5g33340.1 68418.m03957 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 437 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +1 Query: 310 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIACLLHNKY 483 P P+ +Y +SIGTPP + DTGS LW C YT + L + Sbjct: 77 PQPQIDLTSNSGEYLMNVSIGTPPFPIMAIADTGSDLLWTQCAPCDDCYTQVDPL----F 132 Query: 484 DSRKSKTY 507 D + S TY Sbjct: 133 DPKTSSTY 140 >At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protein-related contains weak similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 452 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 QY+ + IG PPQS ++ DTGS +WV C Sbjct: 83 QYFVDLRIGQPPQSLLLIADTGSDLVWVKCSAC 115 >At2g28040.1 68415.m03399 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 395 Score = 37.1 bits (82), Expect = 0.015 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 9/90 (10%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC-HYTNIACLLHNKYDSRKSKTYVA--- 513 +Y + IGTPP + V DTGS ++W C H N + +D KS T+ Sbjct: 64 EYLMKLQIGTPPFEIEAVLDTGSEHIWTQCLPCVHCYNQTAPI---FDPSKSSTFKEIRC 120 Query: 514 ----NGTQFAIQYGSGSLS-GFLSTDDVTV 588 + + + YG S + G L T+ VT+ Sbjct: 121 DTHDHSCPYELVYGGKSYTKGTLVTETVTI 150 >At1g64830.1 68414.m07350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 431 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +1 Query: 298 DVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIACLL 471 D + SP+ +Y ISIGTPP + DTGS +W C Y + L Sbjct: 69 DASPNSPQSFITSNRGEYLMNISIGTPPVPILAIADTGSDLIWTQCNPCEDCYQQTSPL- 127 Query: 472 HNKYDSRKSKTY 507 +D ++S TY Sbjct: 128 ---FDPKESSTY 136 >At3g18490.1 68416.m02350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 500 Score = 36.7 bits (81), Expect = 0.019 Identities = 29/101 (28%), Positives = 43/101 (42%), Gaps = 17/101 (16%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKTYVA- 513 +Y+ I +GTP + +V DTGS W+ P C+ + + KS T A Sbjct: 161 EYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCADCYQQSDPVFNPTSSSTYKSLTCSAP 220 Query: 514 ------------NGTQFAIQYGSGSLS-GFLSTDDVTVGGA 597 N + + YG GS + G L+TD VT G + Sbjct: 221 QCSLLETSACRSNKCLYQVSYGDGSFTVGELATDTVTFGNS 261 >At5g43100.1 68418.m05261 aspartyl protease family protein low similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 631 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 367 IGTPPQSFKVVFDTGSSNLWVPSKKC 444 IGTPPQ F ++ DTGS+ +VP C Sbjct: 82 IGTPPQEFALIVDTGSTVTYVPCSTC 107 >At3g51360.1 68416.m05624 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 488 Score = 36.3 bits (80), Expect = 0.025 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 507 +Y ++IGTP Q F V DTGS W+P C+ T + + ++ + K Y Sbjct: 89 HYANVTIGTPAQWFLVALDTGSDLFWLPC-NCNSTCVRSMETDQGERIKLNIY 140 >At1g66180.1 68414.m07512 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 430 Score = 36.3 bits (80), Expect = 0.025 Identities = 34/119 (28%), Positives = 52/119 (43%), Gaps = 7/119 (5%) Frame = +1 Query: 172 FFLALIASSVMALYRVPLHRMK-TARTHFHEVGTELELLRLKYDVTGPSPE-PLSNYLDA 345 FFL ++ S +PL + + T+ H T L L K PSP P N+ Sbjct: 12 FFLNYVSLSTSLSLHLPLTSLPISTTTNSHRFTTSL--LSRK----NPSPSSPPYNFRSR 65 Query: 346 QYYGV-----ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 507 Y + + IGTPPQ+ ++V DTGS W+ +CH + +D S ++ Sbjct: 66 FKYSMALIISLPIGTPPQAQQMVLDTGSQLSWI---QCHRKKLPPKPKTSFDPSLSSSF 121 >At1g01300.1 68414.m00046 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 485 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKTY 507 +Y+ + +GTP + +V DTGS +W+ P ++C+ + +D RKSKTY Sbjct: 141 EYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPI-----FDPRKSKTY 192 >At3g59080.1 68416.m06586 aspartyl protease family protein contains similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum]; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 535 Score = 35.9 bits (79), Expect = 0.033 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 507 +Y+ + +G+PP+ F ++ DTGS W+ C+ C N YD + S +Y Sbjct: 169 EYFMDVLVGSPPKHFSLILDTGSDLNWIQCLPCY----DCFQQNGAFYDPKASASY 220 >At3g50050.1 68416.m05472 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 632 Score = 35.5 bits (78), Expect = 0.044 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +1 Query: 337 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN--KYDSRKSKTY 507 ++ Y + IGTPPQ F ++ D+GS+ +VP C C H K+ S TY Sbjct: 89 INGYYTTRLWIGTPPQMFALIVDSGSTVTYVPCSDCE----QCGKHQDPKFQPEMSSTY 143 >At3g02740.1 68416.m00266 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 488 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 Y+ I +GTP + F V DTGS LWV C Sbjct: 85 YFAKIGLGTPSRDFHVQVDTGSDILWVNCAGC 116 >At2g42980.1 68415.m05332 aspartyl protease family protein contains pfam profile: PF00026 eukaryotic aspartyl protease Length = 527 Score = 35.5 bits (78), Expect = 0.044 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 447 +Y+ + +GTPP+ F ++ DTGS W+ C+ Sbjct: 159 EYFMDVLVGTPPKHFSLILDTGSDLNWLQCLPCY 192 >At5g02190.1 68418.m00140 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 453 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 361 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 507 +++GTPPQ+ +V DTGS W+ + N N +D +S +Y Sbjct: 77 LTVGTPPQNISMVIDTGSELSWLRCNRSSNPNPV----NNFDPTRSSSY 121 >At3g61820.1 68416.m06939 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 483 Score = 35.1 bits (77), Expect = 0.059 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKTY 507 +Y+ + +GTP + +V DTGS +W+ P K C+ A +D +KSKT+ Sbjct: 134 EYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQTDAI-----FDPKKSKTF 185 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 34.7 bits (76), Expect = 0.077 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVP 432 +Y + +GTP F V DTGS WVP Sbjct: 107 HYTTVKLGTPGMRFMVALDTGSDLFWVP 134 >At3g20015.1 68416.m02532 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 386 Score = 34.7 bits (76), Expect = 0.077 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 18/98 (18%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCH--------------YTNIACLLH 474 +Y+ I +G+PP+ +V D+GS +WV P K C+ YT ++C Sbjct: 46 EYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSC-GS 104 Query: 475 NKYDSRKSKTYVANGTQFAIQYGSGSLS-GFLSTDDVT 585 + D ++ + G ++ + YG GS + G L+ + +T Sbjct: 105 SVCDRIENSGCHSGGCRYEVMYGDGSYTKGTLALETLT 142 >At1g44130.1 68414.m05097 nucellin protein, putative similar to nucellin GI:2290202 from [Hordeum vulgare] Length = 405 Score = 34.7 bits (76), Expect = 0.077 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 322 PLS-NYLDAQYYGVI-SIGTPPQSFKVVFDTGSSNLWV 429 PLS N YY V+ IG+PP++F+ DTGS WV Sbjct: 38 PLSGNVFPLGYYSVLMQIGSPPKAFQFDIDTGSDLTWV 75 >At2g17760.1 68415.m02057 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 513 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTN 456 +Y +++GTP F V DTGS W+P C TN Sbjct: 104 HYANVTVGTPSDWFMVALDTGSDLFWLP---CDCTN 136 >At5g10760.1 68418.m01250 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 464 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 Y I IGTP +VFDTGS W + C Sbjct: 132 YIVTIGIGTPKHDLSLVFDTGSDLTWTQCEPC 163 >At3g51330.1 68416.m05619 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 529 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVP 432 +Y +S+GTP F V DTGS W+P Sbjct: 102 HYANVSVGTPATWFLVALDTGSDLFWLP 129 >At1g77480.2 68414.m09023 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 432 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWV 429 YY +++IG PP+ F + DTGS WV Sbjct: 67 YYVLLNIGNPPKLFDLDIDTGSDLTWV 93 >At1g77480.1 68414.m09022 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 466 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWV 429 YY +++IG PP+ F + DTGS WV Sbjct: 67 YYVLLNIGNPPKLFDLDIDTGSDLTWV 93 >At2g39710.1 68415.m04872 aspartyl protease family protein contains profile Pfam PF00026: Eukaryotic aspartyl protease; contains Prosite PS00141: Eukaryotic and viral aspartyl proteases active site.; Length = 442 Score = 32.7 bits (71), Expect = 0.31 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 361 ISIGTPPQSFKVVFDTGSSNLWVPSKK 441 +++G PPQ+ +V DTGS W+ KK Sbjct: 69 LAVGDPPQNISMVLDTGSELSWLHCKK 95 >At1g09750.1 68414.m01094 chloroplast nucleoid DNA-binding protein-related contains Pfam profile PF00026: Eukaryotic aspartyl protease;b similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 449 Score = 32.7 bits (71), Expect = 0.31 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +1 Query: 316 PEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSR 492 P N L Y V +GTPPQ +V DT + +W+P C + A +++ Sbjct: 92 PVASGNQLHIGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSNA---STSFNTN 148 Query: 493 KSKTY 507 S TY Sbjct: 149 SSSTY 153 >At5g10770.1 68418.m01252 chloroplast nucleoid DNA-binding protein, putative similar to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 474 Score = 32.3 bits (70), Expect = 0.41 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 349 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 Y + +GTP ++FDTGS W + C Sbjct: 132 YIVTVGLGTPKNDLSLIFDTGSDLTWTQCQPC 163 >At5g37540.1 68418.m04521 aspartyl protease family protein weak similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Prosite PS00141: Eukaryotic and viral aspartyl proteases active site; contains 1 predicted transmembrane domain Length = 442 Score = 31.1 bits (67), Expect = 0.95 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 361 ISIGTPPQSFKVVFDTGSSNLWVPSKKCH 447 + IGTP QS ++V DTGS W+ +CH Sbjct: 84 LPIGTPSQSQELVLDTGSQLSWI---QCH 109 >At2g03200.1 68415.m00273 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 461 Score = 31.1 bits (67), Expect = 0.95 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 361 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 +SIG P + + DTGS +W K C Sbjct: 111 LSIGNPAVKYSAIVDTGSDLIWTQCKPC 138 >At4g33490.1 68417.m04756 nucellin protein, putative similar to nucellin GI:2290202 from [Hordeum vulgare] Length = 425 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 349 YYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACL 468 YY V I+IG PP+ + + DTGS W+ +C + CL Sbjct: 59 YYNVTINIGQPPRPYYLDLDTGSDLTWL---QCDAPCVRCL 96 >At3g54400.1 68416.m06015 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 425 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +1 Query: 364 SIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 504 +IGTP Q V DT + W+P C + C +D KS + Sbjct: 93 NIGTPAQPMLVALDTSNDAAWIPCSGC----VGCSSSVLFDPSKSSS 135 >At5g07030.1 68418.m00796 aspartyl protease family protein contains Pfam profile:PF00026 eukaryotic aspartyl protease Length = 439 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +1 Query: 367 IGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 507 IGTP Q + DT S W+P C + C + + KS ++ Sbjct: 105 IGTPAQPLLLAMDTSSDVAWIPCSGC----VGCPSNTAFSPAKSTSF 147 >At4g30030.1 68417.m04273 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 424 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 343 AQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 A + ISIG PP ++ DTGS W+ C Sbjct: 76 AAFLANISIGNPPVPQLLLIDTGSDLTWIHCLPC 109 >At1g52190.1 68414.m05889 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 607 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +1 Query: 361 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVAN 516 +S+ SF + S + PS+K + N ACL+ N+ + S + N Sbjct: 264 LSLPDHHDSFDCYYHMKDSEIKAPSQKLRFLNKACLISNREEEIGSDGFALN 315 >At1g03220.1 68414.m00300 extracellular dermal glycoprotein, putative / EDGP, putative similar to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741 Length = 433 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKK 441 QY VI+ TP VVFD G LWV K Sbjct: 43 QYTTVINQRTPLVPASVVFDLGGRELWVDCDK 74 >At4g30040.1 68417.m04274 aspartyl protease family contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 427 Score = 28.3 bits (60), Expect = 6.7 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +1 Query: 361 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTYVANGTQFAI 534 ISIG+PP + + DT S LW+ C I C + +D +S T+ N T Sbjct: 89 ISIGSPPITQLLHMDTASDLLWIQCLPC----INCYAQSLPIFDPSRSYTH-RNETCRTS 143 Query: 535 QYGSGSL 555 QY SL Sbjct: 144 QYSMPSL 150 >At1g25510.1 68414.m03168 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 483 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 346 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 444 +Y+ + IG P + +V DTGS W+ C Sbjct: 147 EYFTRVGIGKPAREVYMVLDTGSDVNWLQCTPC 179 >At5g38950.1 68418.m04710 germin-like protein-related contains some similarity to germin-like protein GI:5869975 from [Triticum aestivum] Length = 104 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 732 GXGPCSPFXVLSXRDPGPXXXXISVGGSNPP 824 G P F LS ++PG +V GSNPP Sbjct: 19 GRSPAVAFAALSSQNPGVISIVNTVFGSNPP 49 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,747,487 Number of Sequences: 28952 Number of extensions: 338697 Number of successful extensions: 925 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 888 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1941125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -