BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_B21 (865 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72050.2 68414.m08328 zinc finger (C2H2 type) family protein ... 35 0.061 At5g55110.1 68418.m06870 stigma-specific Stig1 family protein si... 31 0.99 At2g04620.1 68415.m00470 cation efflux family protein potential ... 31 0.99 At1g55860.1 68414.m06406 ubiquitin-protein ligase 1 (UPL1) nearl... 31 1.3 At3g08670.1 68416.m01007 expressed protein 30 2.3 At4g22210.1 68417.m03210 hypothetical protein 29 3.0 At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi... 29 3.0 At3g57120.1 68416.m06359 protein kinase family protein contains ... 29 4.0 At3g08660.1 68416.m01006 phototropic-responsive protein, putativ... 29 4.0 At5g43030.1 68418.m05250 DC1 domain-containing protein contains ... 29 5.3 At5g42140.1 68418.m05130 zinc finger protein, putative / regulat... 29 5.3 At4g16920.1 68417.m02552 disease resistance protein (TIR-NBS-LRR... 29 5.3 At2g02700.1 68415.m00210 DC1 domain-containing protein contains ... 29 5.3 At2g02690.1 68415.m00208 hypothetical protein 29 5.3 At4g26880.1 68417.m03868 stigma-specific Stig1 family protein si... 28 7.0 At2g02630.1 68415.m00202 DC1 domain-containing protein contains ... 28 7.0 At1g28050.1 68414.m03434 zinc finger (B-box type) family protein 28 7.0 At5g65840.1 68418.m08285 expressed protein 28 9.2 At3g49970.1 68416.m05464 phototropic-responsive protein, putativ... 28 9.2 >At1g72050.2 68414.m08328 zinc finger (C2H2 type) family protein contains multiple zinc finger domains: PF00096: Zinc finger, C2H2 type Length = 412 Score = 35.1 bits (77), Expect = 0.061 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 4/88 (4%) Frame = +2 Query: 176 CSICNAEFLDPGDLKQHLKVHSTVSTDTERRKTC--DFCECKYADVEEYAYHIRDSHLAA 349 C C AEF P LKQH++ HS ER TC D C Y + H+ +H Sbjct: 68 CQECGAEFKKPAHLKQHMQSHS-----LERSFTCYVDDCAASYRRKDHLNRHLL-THKGK 121 Query: 350 SKFC--QLCSRVFIDFNKYKQHTRKHYT 427 C + C F +H +K+++ Sbjct: 122 LFKCPKENCKSEFSVQGNVGRHVKKYHS 149 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +2 Query: 332 DSHLAASKFCQLCSRVFIDFNKYKQHTRKHYTAKSEYNACSQCSALYINEMELERH 499 D +++ CQ C F KQH + H +S C+A Y + L RH Sbjct: 59 DEESSSNHTCQECGAEFKKPAHLKQHMQSHSLERSFTCYVDDCAASYRRKDHLNRH 114 >At5g55110.1 68418.m06870 stigma-specific Stig1 family protein similar to stigma-specific protein STIG1 [Nicotiana tabacum] GI:496647; contains Pfam profile PF04885: Stigma-specific protein, Stig1 Length = 163 Score = 31.1 bits (67), Expect = 0.99 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = -2 Query: 573 STDDRNGYRLCRNTPSSTCLWFSTSCRSNSISLMYSAEHCEHALY-SDLAV*CFRVCCLY 397 STDD+N LC+N C + T CR + + Y HC + DL C C Y Sbjct: 108 STDDKN-CGLCKNK----CKFGQTCCRGQCVYVAYDKRHCGECNHRCDLGEFCVYGLCNY 162 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +2 Query: 407 HTRKHYTAKSEYNACSQCSALYINEMELERHEVENHKHVD---EGVFLHNLYPFLSSV 571 H +H + + C+ + + ++ + E+ E + H+H+D EG+FLH L + SV Sbjct: 615 HDHEHQSHSHNHEECNH-NHDHHSDHQPEKSEKKEHRHIDHNMEGIFLHVLADTMGSV 671 >At1g55860.1 68414.m06406 ubiquitin-protein ligase 1 (UPL1) nearly identical to ubiquitin-protein ligase 1 [Arabidopsis thaliana] GI:7108521; E3, HECT-domain protein family; similar to GI:7108521, GB:AAF36454 from [Arabidopsis thaliana] Length = 3891 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -2 Query: 210 PGSRNSALHIEHITSTSASYCRSLSMFKTVSKFASPPMVVQRL 82 PG RN H + + T +YCR+L F + SP Q L Sbjct: 1389 PGERNIWSHSKWLVDTLQNYCRALDYFVNSTYLLSPTSQTQLL 1431 >At3g08670.1 68416.m01007 expressed protein Length = 567 Score = 29.9 bits (64), Expect = 2.3 Identities = 36/129 (27%), Positives = 63/129 (48%), Gaps = 7/129 (5%) Frame = +3 Query: 117 SRPS*TSTMIYSTMLKSM*YVQYATRSFSIPEI*NNT*KFTARY-RPTRSGGRRATSANA 293 SRP+ +S++ ++ S Y + T S I N + + Y RP+ R ++SA Sbjct: 149 SRPARSSSVTRPSISTSQ-YSSF-TSGRSPSSILNTSSASVSSYIRPSSPSSRSSSSARP 206 Query: 294 NTPTSRNTLTTYAT--RISPPRSFASFVRVCLSI----STNTNSIRESIIPPNLNTTRAR 455 +TPT ++ + +T RI P S +S + S+ ST T+ + S PN+ +R Sbjct: 207 STPTRTSSASRSSTPSRIRPGSSSSSMDKARPSLSSRPSTPTSRPQLSASSPNIIASRP- 265 Query: 456 NAQRCTSTK 482 N++ T T+ Sbjct: 266 NSRPSTPTR 274 >At4g22210.1 68417.m03210 hypothetical protein Length = 86 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/73 (26%), Positives = 34/73 (46%) Frame = -2 Query: 621 SESSALTLVNVDIFMFSTDDRNGYRLCRNTPSSTCLWFSTSCRSNSISLMYSAEHCEHAL 442 S + +V + I + S D G R+C + + FS + + NS+ ++ C A Sbjct: 7 STFAVAVVVCLSILLMSPTD--GRRVCDSAAGLCSMLFSCNTQCNSLGRNFTGGECSDAR 64 Query: 441 YSDLAV*CFRVCC 403 + L+V C+ CC Sbjct: 65 FPGLSV-CY--CC 74 >At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar to 60S ribosomal protein L29 GB:P25886 from (Rattus norvegicus) Length = 83 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 341 LAASKFCQLCSRVFIDFNKYKQHTRKHYTAKSEYN 445 LA+ F QLC V + K K HT + +AK+ N Sbjct: 7 LASLPFTQLCCAVVTEMAKSKNHTAHNQSAKAHKN 41 >At3g57120.1 68416.m06359 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 456 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 4/68 (5%) Frame = +3 Query: 243 RYRPTRSGGR----RATSANANTPTSRNTLTTYATRISPPRSFASFVRVCLSISTNTNSI 410 R RP++S GR R + + +NT T+ T T+ + + S + ++ T+ S+ Sbjct: 34 RSRPSQSQGRHPSTRRSPSTSNTGTTTTTTTSNSNKTGASSSSSGAASSSVASRTSLASL 93 Query: 411 RESIIPPN 434 RES +P N Sbjct: 94 RES-LPEN 100 >At3g08660.1 68416.m01006 phototropic-responsive protein, putative contains similarity to root phototropism RPT2 [Arabidopsis thaliana] gi|6959488|gb|AAF33112, a signal transducer of phototropic response PMID:10662859 Length = 582 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 215 LKQHLKVHSTVSTDTERRKTCDFCECKYADVEEYAYHI 328 + +LK H + T+ ER+K C+F +CK +E + H+ Sbjct: 410 IDMYLKAHPLL-TEEERKKLCNFIDCKKLS-QEASNHV 445 >At5g43030.1 68418.m05250 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 564 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 420 IIPPNLNTTRARNAQRCTSTKWN*NGTRWKTINTSMKAYSCITCT 554 +I N + R + R S W+ R K +N AYSC+TCT Sbjct: 165 VICVNRHDHRISHVPRLGSGNWSCGVCR-KEVNGMYGAYSCLTCT 208 >At5g42140.1 68418.m05130 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1073 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 270 RRATSANANTPTSRNTLTTYATRISPPRSFASF-VRVCLSISTNTNSIRESIIPPN 434 RR A TP+S ++ ++ R SPPRS + V L ST SI ES+ N Sbjct: 768 RRGPPKPAVTPSSSRPVSPFSRRSSPPRSVTPIPLNVGLGFST---SIAESLKKTN 820 >At4g16920.1 68417.m02552 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1304 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 5/76 (6%) Frame = -2 Query: 501 SCRSNSISLMYSAEHCEHALYSDLAV*CFRVCCLYLLKSINTR-----EQSWQNFEAARC 337 SC S ++ Y+ E ALY D F+ CC +K R +++ N + R Sbjct: 1169 SCVPLSENIEYTCERFWDALYDDDYKNYFKFCCSNRIKECGVRLLYVYQETEYNQQTTRS 1228 Query: 336 ESRMW*AYSSTSAYLH 289 E RM ++ Y++ Sbjct: 1229 EKRMGMTSGTSEEYIN 1244 >At2g02700.1 68415.m00210 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 499 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/68 (27%), Positives = 28/68 (41%) Frame = +2 Query: 440 YNACSQCSALYINEMELERHEVENHKHVDEGVFLHNLYPFLSSVLNMKMSTFTKVKADDS 619 Y C +C Y E E+ HV + L+N+ F +L+ K KA+ Sbjct: 142 YYFCVECDQRYHKECVESPLEINYPSHVKHSLQLYNVKTFEHCILSTK-------KAEVL 194 Query: 620 DYSCTVCD 643 Y C +CD Sbjct: 195 LYYCALCD 202 >At2g02690.1 68415.m00208 hypothetical protein Length = 623 Score = 28.7 bits (61), Expect = 5.3 Identities = 23/94 (24%), Positives = 38/94 (40%) Frame = +2 Query: 89 CTTMGGDANFETVLNIDNDLQYDAEVDVICSICNAEFLDPGDLKQHLKVHSTVSTDTERR 268 C M +E ++ D Y+ +DV+C A +P D + H +S D + Sbjct: 449 CNRMSNSFGYECLME---DCGYN--LDVVC----ASISEPFDYQGHHHP-LFLSLDPKEE 498 Query: 269 KTCDFCECKYADVEEYAYHIRDSHLAASKFCQLC 370 C C +Y E Y R + + +C+LC Sbjct: 499 PICHIC--RYKHDEHYLTFCRGDEASGADWCELC 530 >At4g26880.1 68417.m03868 stigma-specific Stig1 family protein similar to stigma-specific protein STIG1 [Nicotiana tabacum] GI:496647; contains Pfam profile PF04885: Stigma-specific protein, Stig1 Length = 152 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = -2 Query: 615 SSALTLVNVDIFMFSTDDRNGYRLCRNTPSSTCLWFSTSCRSNSISLMYSAEHC 454 +S +T N S+DD N C+N C + T CR + + Y HC Sbjct: 83 NSTMTCCNNKCIDVSSDDNN-CGACKNK----CKFSQTCCRGQCVYVAYDKRHC 131 >At2g02630.1 68415.m00202 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 440 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 7/61 (11%) Frame = +2 Query: 485 ELERHEVENHKHVDEGVFL-----HNLYPFLSSVLN-MKMSTFTKVKADDSD-YSCTVCD 643 E+E +VE+ K + +GV L H+LY +S V N K + ++ + Y C CD Sbjct: 136 EVEEDDVESFKRIADGVILHFSHRHHLYFEISGVYNGNKFCQACALPVNEGNLYVCVGCD 195 Query: 644 Y 646 + Sbjct: 196 F 196 >At1g28050.1 68414.m03434 zinc finger (B-box type) family protein Length = 433 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 663 IFTYNIYKRKTVGSLACDSCGN 728 + T N+ RK V S CD+CGN Sbjct: 36 VHTANLLSRKHVRSQICDNCGN 57 >At5g65840.1 68418.m08285 expressed protein Length = 275 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 287 ECKYADVEEYAYHIRDSH--LAASKFCQLCSRVFIDFNKYKQHTRKHYTAKS 436 EC YAD E AY + + L + F ++VF F++ ++ T K+YT ++ Sbjct: 175 ECLYADPERKAYDVLGLYFGLGRTFFNPASTKVFSRFSEIREAT-KNYTIEA 225 >At3g49970.1 68416.m05464 phototropic-responsive protein, putative similar to root phototropism RPT2 [Arabidopsis thaliana] gi|6959488|gb|AAF33112, a signal transducer of phototropic response PMID:10662859 Length = 526 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 227 LKVHSTVSTDTERRKTCDFCECKYADVEEYAY 322 LK H +S + E++K C +CK + YA+ Sbjct: 368 LKTHPNIS-EVEKKKVCSLMDCKKLSRDVYAH 398 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,075,170 Number of Sequences: 28952 Number of extensions: 358914 Number of successful extensions: 1253 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1248 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -