BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_B15 (860 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0114 - 886404-887111 31 1.6 05_07_0146 + 28018236-28018580,28018670-28018777,28018984-280191... 30 2.7 >11_01_0114 - 886404-887111 Length = 235 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 4/82 (4%) Frame = +2 Query: 386 TPSSSTNGTETLVPEDNLYALMPPFETFLNVD----KTARLRHFFDNVKTGELIIGAVIN 553 T +++ NG+ +++P + A PPF T + D + R R L++ V+ Sbjct: 5 TAAAAGNGSGSILPTHTIAATAPPFRTHKDADLESRRRRRRRRCLCCCLLVTLVVLLVLA 64 Query: 554 RTASGMMLKVLCTAGPTSRYVA 619 T + L VL PT+R V+ Sbjct: 65 ITLLVLFLTVLRVRDPTTRLVS 86 >05_07_0146 + 28018236-28018580,28018670-28018777,28018984-28019148, 28019269-28019736,28019823-28019936,28020038-28020715 Length = 625 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = -3 Query: 465 VSNGGINAYKLSSGTRVSVPLVDDEGVSSSKEESNKAPASLAM 337 ++ G + + +SG+ S+ VDD GVSS+ EE +A A+LA+ Sbjct: 114 INMGLLVGRRRNSGSEESI--VDDGGVSSNDEEHREAKAALAV 154 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,587,895 Number of Sequences: 37544 Number of extensions: 393338 Number of successful extensions: 816 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -