BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_B11 (851 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 23 4.7 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 4.7 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 157 KVVSARGPIPAHLLGNMWAQTWNNIESFTR 246 K VS G + L+GN WN +S R Sbjct: 307 KAVSKNGVLFVGLVGNSAVGCWNEHQSLQR 336 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.6 bits (46), Expect = 4.7 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +2 Query: 371 EKFWKNSIIEKPTDREIV 424 ++ W +I E+PT E++ Sbjct: 290 KQMWSQNITERPTTNEVI 307 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 234,331 Number of Sequences: 438 Number of extensions: 4989 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -