BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_B05 (852 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 0.87 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 24 1.5 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 8.2 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 8.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 8.2 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.8 bits (44), Expect(2) = 0.87 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 420 HGPHSLRGRDSWTPEGS 370 HG H L G S P GS Sbjct: 138 HGLHGLHGLSSSAPTGS 154 Score = 21.4 bits (43), Expect(2) = 0.87 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -1 Query: 492 KERNSRDI*SCRRGAGILFPTTACHGPHSLRG 397 KE+ SR+ RR L T HG H L G Sbjct: 111 KEQLSREQRFLRRRLEQLTNQTGLHGLHGLHG 142 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -1 Query: 174 FLLRYRCLTHLCLCLPSDILYVYEIW-LNRI 85 +LL +CLT +CL S I+ +W +N+I Sbjct: 381 YLLGIQCLTVVCLAFWSFIVSTILLWFINKI 411 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.8 bits (44), Expect = 8.2 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 789 VXAPNRPCPCRGRTRASRRANPGRERP 709 + P P P R R A +A PG RP Sbjct: 50 IPQPRPPHP-RLRREAEPKAEPGNNRP 75 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 8.2 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = +1 Query: 472 IPRISFFYAETTSVP----ASIGFMGFTMSAKGGITLNYGRRSQTASTVF 609 I R + +Y VP AS+ +GFT+ G L+ G + TVF Sbjct: 227 IRRRTLYYFFNLIVPCVLIASMAVLGFTLPPDSGEKLSLGVTILLSLTVF 276 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 8.2 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 671 ASYGTDPADHEADGRSRPGFALRLALVRPRQGHGRXGAXTIAESASLL 814 AS T H RP F LALVR G T A+ LL Sbjct: 636 ASGLTKARGHSLLVADRPNFVTILALVRDATARLPNGEGTRADICQLL 683 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 245,903 Number of Sequences: 438 Number of extensions: 5253 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -