BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_B03 (858 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 132 3e-31 SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) 42 8e-04 SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) 31 1.6 SB_57110| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-22) 29 3.7 SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) 29 4.8 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 29 6.4 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 28 8.5 SB_871| Best HMM Match : 7tm_1 (HMM E-Value=0.0017) 28 8.5 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 132 bits (320), Expect = 3e-31 Identities = 76/166 (45%), Positives = 103/166 (62%) Frame = +1 Query: 28 MAAGVLYTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFES 207 MAAG LYTYP++FRA K LIAA+YSGT ++V P F FG+ N + +FLKKFP GKVPAFE+ Sbjct: 1 MAAGKLYTYPDSFRAQKILIAAEYSGTKIEV-PAFTFGKDNHTAEFLKKFPLGKVPAFET 59 Query: 208 ADGKVLLTESNAIAYYVANESLRGGDLATQARVWQWASWSDSELLPASCAWVFLYLGIMQ 387 AN R L T + +++D ELLPA+ WVF G+MQ Sbjct: 60 K---------------TANACTRAMPLLTT-----YVNFADQELLPAAATWVFPTYGMMQ 99 Query: 388 FNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTL 525 ++KQ+ ++A D+ + +L+ LL +TFLV ER+TLAD+ V L Sbjct: 100 YHKQSTDKAMEDVKKYMTMLNDVLLMKTFLVGERVTLADIAVCCVL 145 >SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) Length = 260 Score = 41.5 bits (93), Expect = 8e-04 Identities = 40/143 (27%), Positives = 63/143 (44%), Gaps = 4/143 (2%) Frame = +1 Query: 178 PAGKVPAFESADGKVLLTESNAIAYYVA--NESLRGGDLATQARVWQWASWSDSELLPAS 351 P +P E+ +G SN I Y+A ++ L G DL + +V QW + + A Sbjct: 45 PFNTLPLLETKEGTFF--SSNTIIRYLAASSDKLYGSDLFQRGQVDQWLDITTCDFEAAV 102 Query: 352 CAWVFLYLGIMQFNKQNVERAK--SDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTL 525 A G ++VE AK +D+ L ++ HL R FLV + +T+AD V +T Sbjct: 103 AAVAIAKEG------RDVEGAKIVADINKFLGFVEKHLAGRKFLVGDSVTIADFSV-ATS 155 Query: 526 LHAFQHVLDPSVRSSLINVQRWF 594 + L R N+ W+ Sbjct: 156 IAVILTSLGDEDRKPYQNIVSWY 178 >SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) Length = 505 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/71 (25%), Positives = 30/71 (42%) Frame = +1 Query: 61 NFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESN 240 N +K + Q + K+ P V GE N + +KK +P GK + + + Sbjct: 105 NIGKFKMVWIDQIDESTKKLKPKMVAGEDNGFVNAIKKVSLEDIPEGNGPSGKAIREKRS 164 Query: 241 AIAYYVANESL 273 I + N+SL Sbjct: 165 IIVNDIENDSL 175 >SB_57110| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-22) Length = 559 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -1 Query: 144 LAKYEIRCYFHISPGILCGDQRFISAEVFRISVKYPGRHGWSFRKE 7 L K +R +I L + FI+ V +S+ G+H WSF KE Sbjct: 200 LRKDSLRTVSNILVAALALSELFITVVVIPLSIIAYGKHLWSFHKE 245 >SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 283 DLATQARVWQWASWSDSELLPASCA 357 DL T A+V+ WA W ++ SCA Sbjct: 78 DLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) Length = 141 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 283 DLATQARVWQWASWSDSELLPASCA 357 DL T A+V+ WA W ++ SCA Sbjct: 78 DLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 190 LFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYK 71 +FR + + + S ++ N V +SHQSR IV T+ K Sbjct: 102 VFRSKQQAPNKAVGRSDEVTNEVAVSHQSRRIVESETVRK 141 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +1 Query: 367 LYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIV 513 ++ +M + K +VE K DL L+ + LLTR FL+ + + D+I+ Sbjct: 190 VFEAVMSWIKHDVESRKKDLANLLEHIRFPLLTRKFLI-DTVAKEDLIM 237 >SB_871| Best HMM Match : 7tm_1 (HMM E-Value=0.0017) Length = 1675 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +3 Query: 465 THLPCYRENHTCRCHCLQYTAACFPARARPERPFVAD---KRSALVP 596 T P +R +HT L+ +PA+ RP+ P A K+ A VP Sbjct: 1581 TQCPIFRPSHTIHHPPLRSRNVRYPAQVRPQYPLQASLNVKKGARVP 1627 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,595,140 Number of Sequences: 59808 Number of extensions: 566679 Number of successful extensions: 1528 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1524 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -